KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110171777Help
Entry
110171777         CDS       T05002                                 

Gene name
ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00350  Tyrosine metabolism
bpec00360  Phenylalanine metabolism
bpec00380  Tryptophan metabolism
bpec01100  Metabolic pathways
Module
bpec_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
bpec_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110171777 (ddc)
   00360 Phenylalanine metabolism
    110171777 (ddc)
   00380 Tryptophan metabolism
    110171777 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpec04147]
    110171777 (ddc)
Enzymes [BR:bpec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110171777 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     110171777 (ddc)
Exosome [BR:bpec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110171777 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110171777
NCBI-ProteinID: XP_020793214
Position
Unknown
AA seq 480 aa AA seqDB search
MNAEEFRRKGKEMVDYVADYLENIEQRPVYPDVEPGYLRHLIPTEAPEDPESFDDLLKDV
DRVIMPGVTHWHSPYFYAYFPTGNSYPSLLADMLSGAIGCVGFTWPASPACTELETVMLD
WLGKMLKLPDCFLAGTHGLGGGVIQSTASEATLVALLAARCKAIRQAQATNHGLSESEIC
SKLVAYTSEQAHSSVERAGLIGGVIMKKVPTDNNYSLSGMLLKKMIEEDKAAGLIPFYLC
ATLGTTSCCSFDNLMELGPICNEENMWMHVDAAYAGSAFICPEYRPLLNGIEFADSFNFN
PHKWLLVNFDCSAMWVKKRADLIGAFKIEPTYLKHDNQESGLVTDYRHWQIPLGRRFRSL
KLWFVFRLFGIKQLQAHIRKHIALAKEFESLVRADKRFEICAEVVLGLVCFRIKGSNELN
QTLLKRITKDRQIHLVPCQLSGRFVLRFCICAHGTESLHVQKAWQHITQLTFELLQEHIN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagaagagtttcgccgtaaagggaaggagatggtcgattatgtggctgattac
ctggagaacatcgagcagcggccagtctatccagatgtggagcctggttatctgaggcat
ctcattcccaccgaggcaccagaggatccagagtctttcgatgacctgctgaaggatgtg
gacagggtcattatgcctggggtgacacactggcacagtccatatttctatgcctacttc
cctacaggcaattcttacccctctttattggccgacatgctgagtggagccattggatgc
gttggattcacctggcctgctagtccagcctgtactgagctggagacagtgatgctggac
tggcttggaaagatgctgaagctgcctgactgtttcttagctggaactcatggccttgga
ggaggtgttatacagtccactgcgagcgaggccacactagtggcattactcgcagccagg
tgtaaagccatcagacaagcccaggctaccaaccacggcctgtcggaatctgaaatctgc
tccaaactagtggcttacacatctgaacaagctcattcgtccgtggagagagctggtctc
attggtggcgtcatcatgaagaaggtccccacagacaacaactattctctgagcggcatg
ctactcaagaagatgatcgaagaagacaaggcagccgggctcatccctttctatttgtgt
gctactcttggtacaacatcctgctgttctttcgataacctcatggaacttggaccgatt
tgtaatgaagaaaatatgtggatgcacgtggatgctgcttatgccgggagtgcattcatc
tgccctgagtacagacctctgctcaatgggattgagtttgcagattctttcaacttcaac
ccacacaaatggcttttagtcaactttgattgctccgctatgtgggtgaagaaaagggca
gacctcattggagcattcaagattgaacctacctacctcaaacatgacaaccaggagtca
ggactggttacagattatcggcattggcagatcccacttggaagaagatttcgctctttg
aaattgtggtttgtctttcgcttatttgggataaaacaattgcaggctcatatacgcaag
catatagctttggccaaagagtttgagagccttgtccgagctgacaagaggtttgagatt
tgtgcagaggtggtgctgggcctggtctgcttcagaatcaagggctccaatgagctgaac
cagactttgttgaagcggatcaccaaggaccgacagatccacctggtgccttgtcaactc
tctggacgctttgtgcttcgcttctgcatctgtgcccatgggaccgagtctctccatgtg
caaaaagcatggcagcacatcacacagctcacctttgagctactgcaggagcatatcaac
taa

DBGET integrated database retrieval system