KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110174385Help
Entry
110174385         CDS       T05002                                 

Gene name
cd79a
Definition
(RefSeq) B-cell antigen receptor complex-associated protein alpha chain
  KO
K06506  CD79A antigen
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bpec04090]
    110174385 (cd79a)
CD molecules [BR:bpec04090]
 Proteins
  110174385 (cd79a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_6 I-set Ig_3 ig ITAM
Motif
Other DBs
NCBI-GeneID: 110174385
NCBI-ProteinID: XP_020796147
Position
Unknown
AA seq 220 aa AA seqDB search
MLGLLLCSFCVLCVQSEITLEADIPSLKVKVAYSVWLKCCFNTTGKIELIWIKQSRESAK
KNILYDSLGDAVNKTNDLGGGKHCGILHIQSTALNDTGYYRCLIKTGPNHVYVYTHGTYL
QVYTPLEKTIKLSESDKNVILITEGILLLLCVILPSAALLVKSKDLNELEKRKVQKEEEN
IYQGLNLDDCYEAYDQLEHLQGNGPYEDVGNNEDMQLEKP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttggggcttcttctctgcagcttttgtgtgctttgtgtgcagagtgagataactttg
gaagccgatatcccttctttgaaagttaaagttgcttactcggtctggctgaagtgctgt
ttcaacaccactgggaaaatagagctcatctggatcaagcaatcaagagaaagtgcaaag
aaaaacattctatatgactctttaggtgacgctgtaaataagacaaacgacttgggaggt
ggaaaacattgtggcattctccacattcagtctaccgcactgaatgatactggctattac
cgctgcttaatcaaaacaggacccaatcatgtttacgtctatactcatggcacttacctg
caagtttatacgcctcttgagaagaccataaaactgagtgaaagtgacaagaatgttatc
ctaatcacagaggggatcctgcttttgttatgtgtgatcctgccatcagccgccctgctt
gtcaagtctaaagacctgaatgagctggagaaaaggaaggtgcaaaaagaagaggagaac
atataccagggcctaaatttggatgactgctatgaagcatatgatcagcttgaacacctg
caaggaaatggcccatatgaagatgtgggaaacaatgaagacatgcaacttgagaaacct
tag

DBGET integrated database retrieval system