KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110174960
Entry
110174960         CDS       T05002                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpec01002]
    110174960
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110174960
Peptidases and inhibitors [BR:bpec01002]
 Metallo peptidases
  Family M1
   110174960
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110174960
NCBI-ProteinID: XP_020796766
Position
Unknown
AA seq 950 aa
MQVGMLPVDTMWATTVLLLVSLSLSLSFGAQLPDQGASKDAPIATNGRPFPWTTMRLPTS
VLPIHYDLSIHPNLTTLDFTGVVRIQLDVRENTDTIVLHAKQMQVSNVFLIGPNGVKPLD
VLEYPRFHQLALVSDTVLTKGRKYEVHLEFAANLSDSFHGFYKGSYKTSSGEVRVLASTQ
FEATFARGAFPCFDEPAFKANFTIQIVREPHHIAVSNMPKVKTVELAGGLLEDHFDTTVK
MSTYLVAYIVCDFLSVSRTTQHGVKISVYAVPEKIDQTAFALNAAVKLLDFYDDYFDIPY
PLPKQDLAAIPDFQSGAMENWGLTTYRETALLFDPEKSSASDKLGITKVIAHELAHQWFG
NLVTMEWWNDLWLNEGFAKFMEYISVDITYPELQVDDFFLGKCFEAMEVDSLSSSHPVST
PVENPTQIQEMFDDVSYDKGACILNMLQDFLSPEAFEIGIIRYLKKYSYQNTVNSDLWES
LTDICNSDVLDLRQTRHKEFCSKSKLQSGASKWYSGDELDVRAIMNTWTLQEGFPLVTVE
VKGQEVRLSQERYLKTNDPSLTEGFLWQIPLTYKTSASNTIHRFLLKTKTDVLYLPEEVS
WVKFNVDMNGYYMVHYAGDGWDSIIKLLRYNHTALSSNDRASLIQNIFQLVSIGKVKLDQ
ALELSLYLSKETEIMAVTQGLGELVPLYKLMEKRDMPVLENQMKDYIVELFRGLIDRQEW
TDSGSVTQRMLRSYLLLFACVRNYLPCVEKATQLFNRWKESDGTMSLPVDVTMAVFVIGA
RTPEGWDFLFEKYRQSMQMSFKSRMKTAMAISPLQDKLIWMLEQSLNGDVMKTQDLPDVL
VSIGRNPLGYKLAWDFLRANWHTLIKKFDLGSHTVSFMVNGVTNQYSTREKLDEVRSFFD
SLTEETGSEMRCIQQAYETIEDNIRWMDTHLPLLQHWLNKRSAKLVHEDL
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgcaggtggggatgttacctgttgacaccatgtgggccactactgtcctgttgctggta
tctctttctctttctctttcatttggagcacaacttccagaccaaggagcttctaaggat
gcccctattgcaaccaatggccggccgtttccctggactaccatgagacttcccacatcc
gtcttacctatccattatgatctgagtatccaccccaacctgaccactttagacttcact
ggggtggtccgtatccagctagatgtccgtgaaaatactgatacaatagtgttacatgcc
aagcagatgcaggtgtccaatgtgtttctaataggccccaatggtgttaagcctctggat
gttttagagtatcctcgattccaccagctggccctcgtttctgacacagttttgaccaaa
ggtagaaagtatgaagttcatcttgagtttgcggctaatctgtccgacagctttcatggg
ttctacaagggcagctataaaacaagcagtggggaggtcagagttctggcatcaacacaa
tttgaagccacttttgccagaggagcatttccatgttttgacgagcctgccttcaaagcc
aattttactattcaaattgtccgggagccacaccacatagcggtatccaacatgcccaag
gtgaaaacagtggagttggctggaggtttgcttgaggatcactttgacaccacagtgaaa
atgagcacatacctcgtagcttacatcgtgtgtgacttcctgtctgtgagccgcaccact
caacatggtgtcaagatttcagtctatgctgtgcctgagaagattgaccagacggctttt
gcactgaatgctgctgtcaaacttctggacttttatgatgactattttgacattccttac
ccactgccaaaacaggatctggctgctatccctgacttccagtccggtgccatggagaac
tggggcctgaccacgtacagagagacagccctgttgtttgacccagagaagtcatcggct
tcagataaactgggcattaccaaagtgatcgcacatgaactggcccatcagtggtttggg
aacttggtgactatggagtggtggaatgatttgtggcttaatgagggctttgctaaattc
atggagtatatctcagtggacatcacctaccctgagctacaagtggatgatttcttcttg
ggaaagtgttttgaggcaatggaggtggactctctgagctcatcccaccctgtgtctact
ccagtggaaaaccccacacagatccaggagatgtttgatgatgtttcctatgataagggg
gcatgcattctcaatatgctgcaagacttcctttctcctgaagcctttgagatcggaatc
attagatacttaaagaaatacagttaccaaaacacagtcaacagtgatttatgggaaagt
ctcactgacatctgcaactcagatgttttagatctgagacaaacgagacacaaggagttc
tgttcaaagagcaaacttcagtctggagcctcaaaatggtactcaggtgatgagctggat
gttcgggccatcatgaacacatggacgctgcaggagggctttcctctggtcactgtggag
gtcaaaggtcaggaggttaggctcagtcaagagcgttacctgaaaaccaatgacccctca
ctcacagaaggatttctatggcaaatccccttgacctacaaaaccagtgcatcaaacacc
atccaccgcttcctgttgaagactaaaactgatgttctgtacctgcctgaggaagtcagc
tgggtcaagttcaatgtggacatgaatggatattatatggtgcactacgctggtgacggc
tgggactccattattaaactgctccggtacaatcacacagccctgagcagcaacgaccgc
gcaagcctcattcaaaacattttccagcttgttagtattgggaaggtgaaactggaccag
gctctggagctgtccctgtacctgtccaaagagactgagattatggcagtgacacaggga
cttggagaacttgtacctctctacaaactgatggagaagcgagacatgccagttcttgaa
aaccagatgaaggactacatagtggagctattccgggggctgattgaccgtcaggagtgg
accgactctgggtccgtgacccagcgcatgctccggagctatctgctgctatttgcctgt
gtcagaaactaccttccctgtgtagagaaggccactcagcttttcaacagatggaaggaa
tcggatggaacaatgagtctcccagttgatgtcacgatggctgtatttgtgattggggcc
cgaacaccagagggatgggattttctgtttgaaaaatatcgtcaatcaatgcaaatgtcc
ttcaagagccgaatgaaaactgccatggctattagccccctgcaggacaaactcatatgg
atgctggagcagagccttaatggggatgtgatgaagactcaggacctcccagatgttttg
gtatcgattggcagaaatcctcttggctacaaacttgcctgggacttcctccgggccaat
tggcacacacttatcaagaaatttgacctcgggtcccacactgtgtcctttatggtgaac
ggtgtgactaaccagtactccaccagagagaagcttgacgaggtgcgcagcttctttgac
tctctgactgaggagactggatcagagatgagatgtatccagcaggcctatgagactatt
gaggataatattcgctggatggacactcacctgcctctgctacagcactggctcaacaag
cgctctgcaaaactggtacatgaggacttgtaa

DBGET integrated database retrieval system