KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110174990Help
Entry
110174990         CDS       T05002                                 

Gene name
tmprss15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpec01002]
    110174990 (tmprss15)
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     110174990 (tmprss15)
Peptidases and inhibitors [BR:bpec01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110174990 (tmprss15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM SEA Ldl_recept_a DUF1986 SRCR_2 PRKCSH-like SRCR Herpes_UL73
Motif
Other DBs
NCBI-GeneID: 110174990
NCBI-ProteinID: XP_020796762
Position
Unknown
AA seq 1298 aa AA seqDB search
MLINCRFQHHKEERLGSTPRREVKVWGPADEPPQPCSGVADCRTLTAPSVVTEFPLHTHM
FMLRLKIHLHSTLSLLCLTWVDRINGSNQLPDPGEDLEKVPLLRFNPGTLEDGSNAEDTA
LGQTHGNVAANLRLLSPHTYIHTGPNLLLLWCSLCLKTLPERSSDTDYEKENVSRLSDSK
NDSQTYYWRMKKFSSLELLLSLMVVILVACTIGLSVVGFTCVQKTGADEGVFLAHLRISG
GANFSEDLTNSSSPQFKTLAFDVQKLVGEAFSLSDLRLQFKSCSVLYFSKGSIVVTIDLR
FLLPMSAPEAEQQLGVGLQLVQGSELVVDLSSVNVTDKGAISTTSVTPPTTTVTSTTTSV
TPPTTTVTSTTTSVTPPTTSVTPPTTTVTPPTTSVTPPTTSVTPPTTTVTPPTTSVTPPT
TSVTPPTTTVTPPTTSVTPGVTPSSSPVPCPDGHMSCSNGSGCVLIGQFCDGHKDCPNGS
DENQSTCATSCDGNFLLQGPNGSFTSSVSGNYSSSTSCRWILRAEPGLSIRVDFLFFETE
ERRDFLRLFEGVGANRRLIADLSGSTPPGRVWLLSDQSSAEFVSDDLGEGRGFRATFNTE
NLTDLSNEQMLSCTFEDGWCFWRRDPDQDQDWIRTRGDQFPTGTGPSEDHTTGTSAGFYV
STPTSPGSWLKTFRILSVPLRPSSGASCLSFWYHMFGADVFFLRVLLLRPDLPDLLLLQR
HGDYGDFWYQGQVQLHNYSHTQVVFEAQKNGGRLNDIALDDITFTSQPCGPAPPXXXXXX
XXXXXXXXXADCGGPFDLHDNGTFSSPNYPDYYGNKANCLWRLHTDAGKNLQLHFLDLDL
ETFYDTLEIRDGPEPNSTLLGVFTGTRGPTHDLFSSTNQMSLIFLTDSSTSGRGFKANFS
SGVNLGSPDPCPVGQFQCVSGLCVSADSECDGHMDCPDGSDEAQCVFLDSERLQFQVTSA
NFSVCSSSWSQPLSNFTCRYLGYRSGLWSPVASRPEDSPFVSVSVSNETIQTDILEKCEN
VVSLNCSNLPCGVRQVNLTFEFNQSEQRGDTGGQSEDAGGGRIVGGVDAAKGAWPWIVSL
WWSGRHVCGGTLIGEDWVLTAAHCVYGKNMHVERWQAVLGLSAQSQPSSPEVQSRPIKRI
IIHPLYDRRIKRADITLMQLQEPVSFSDYVQPVCLAELDPPPGTLCSIAGWGRLSSGGSL
PDVLQEAQVPLVPQTLCQEQLPQYNISDLMLCAGREEGGTDTCQGDSGGPLMILQNGHWT
QIGVTSFGDGCGDPQSPGVYARVSAFTSWITQMQRSHG
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaactgtaggttccaacaccacaaggaggagaggcttggctccacaccccgg
cgggaggtcaaagtttggggtcccgcagacgaacccccgcagccgtgcagtggtgttgct
gattgtcggacactcactgcccccagcgtcgtcacagagttccccctgcacactcacatg
ttcatgctcagactcaagatccatctccactccacactctcactcctctgtctgacatgg
gttgacaggattaatggttccaaccagctgcctgaccctggagaagatctggagaaggtc
ccactgctcaggtttaaccccgggacactggaggatgggtcaaatgcagaggacactgcc
ctgggtcagactcatggaaatgtggcagctaatctgcgcctcttgtcaccacacacatac
attcacacaggaccaaacctgcttctgctctggtgttcgttgtgtttgaagactctgcct
gagcgttcctctgacacagattatgaaaaggagaacgtgtccagactcagtgattctaaa
aatgattcacaaacatattactggaggatgaagaagttctcgtctctggagctgctcctc
agcctcatggtggttattctggttgcctgcaccatcggcctcagcgtcgtcggcttcacc
tgcgtccaaaagacaggagcagacgagggcgtgttcttggcccacttgaggatctcggga
ggagcaaacttctctgaggacctcacaaactcctcgtctcctcagttcaaaactcttgcc
tttgacgtccagaagctggtgggcgaggccttttctctcagtgacctcaggctccagttc
aaatcctgctccgtgctgtacttcagcaaaggcagcattgtggtgaccattgacctgcgc
ttcctacttcccatgagtgccccggaggcggagcaacaactgggggtggggcttcagctc
gtccaaggctcggaattggttgttgacctgagcagcgtgaacgtgacagacaaaggagcc
atttcgaccacctctgtgacccctcccaccaccactgtgacctctaccaccacctctgtg
acccctcccaccaccactgtgacctctaccaccacctctgtgacccctcccaccacctct
gtgacccctcccaccaccactgtgacccctcccaccacctctgtgacccctcccaccacc
tctgtgacccctcccaccaccactgtgacccctcccaccacctctgtgacccctcccacc
acctctgtgacccctcccaccaccactgtgacccctcccaccacctcagtgactccaggt
gtgacccccagctcctctccagttccgtgtccggacggtcacatgagctgctccaacggc
tcaggctgcgttctgattggtcaattctgtgacggacacaaagactgtcccaatggatca
gacgagaaccagagcacctgcgcgacgtcgtgcgatggcaatttcttgctccagggcccc
aatggctccttcacttcctccgtgagtgggaactacagcagctccacttcctgtcgttgg
atcctcagggcggagccaggcctgtcaatcagagtagacttcctcttcttcgagacggag
gagaggcgggacttcctgcggctgttcgagggcgtgggagcgaaccggcggctgatcgct
gacctctcaggctccacccctccaggaagagtgtggctgctgagcgaccaatcatcagcg
gagtttgtgtcggatgacctgggagaggggcggggtttcagggccacgttcaacactgag
aatttaactgacctcagcaatgagcagatgctgagctgtaccttcgaggacggttggtgt
ttctggagacgagacccagaccaagaccaggactggatcaggaccagaggagatcagttc
cccacagggaccggacccagtgaggaccacaccacagggaccagcgcagggttttatgtg
tcgactccgaccagtcctgggtcttggttgaagactttccggatcctgagtgttcctctg
agaccatcctctggcgcctcttgtctgtccttctggtatcacatgttcggagcagacgtg
ttcttcctcagggtcctgctgctccggccggacctgccagacctgctcctgctgcagaga
cacggggactacggggacttctggtatcaaggccaagtccagttacacaactacagtcac
acacaggtggtgtttgaggctcagaaaaatggaggccggttgaacgacatcgctcttgat
gacatcaccttcacgtcacagccctgtggccccgcccccccacannnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnncagccgactgcggagggccgttcgatctccatgac
aacggcaccttcagctcgcccaactaccccgattattacggcaacaaggccaactgtctg
tggaggcttcacactgatgcggggaaaaaccttcagctccattttctggacttggacctg
gagacgttctacgacactttggagatcagagacggaccagagccgaattctactctgctc
ggtgtgttcactggaaccagaggccccacccacgacctcttctcctcgaccaatcagatg
tccctaatattcttgacggacagctcaacctcgggccgaggtttcaaggcaaacttcagc
tccggggtcaatctggggtcaccagatccctgccctgttggacagttccagtgcgtttct
ggtctctgtgtttccgctgactctgagtgtgatggacacatggactgtccagacggaagc
gacgaggcccagtgcgtgttcttggactcggagcgtcttcagttccaggtgacctccgca
aacttctccgtgtgttcatcctcgtggagccagcctctgtccaatttcacctgcagatac
ctgggatacaggtctggactctggagcccggtcgcgtctcgtcccgaagattctccgttt
gtctccgtgtctgtgtcaaacgagaccatccaaacagatatactggagaagtgtgagaac
gtcgtgtctctgaactgcagcaacctcccctgtggagtccgacaggtgaacctcacgttt
gagtttaaccaatcagagcagagaggagacacaggtggccaatcagaggacgccggaggt
gggcggatcgtggggggagttgatgcggcgaagggggcgtggccgtggattgtgtctctt
tggtggtcggggcgtcacgtgtgtggaggaactctgattggtgaagactgggtcctgacg
gccgcccactgcgtctacgggaagaacatgcacgtggagcggtggcaggcagtgctgggc
ctcagcgcccaatcacaaccctccagtcccgaggtgcagtcccgaccaatcaaacgcatc
attatacacccgctgtacgaccggcgaatcaaacgcgccgacatcaccctgatgcagctg
caggagccagtcagcttcagcgattacgtgcagccggtgtgtctggcggagctggacccg
ccccccgggactctctgctccattgcgggctggggacgcctgtcgagtggaggttctctc
cctgatgttctgcaggaggctcaggttcctctggttcctcagactctgtgtcaggagcag
ctgcctcagtacaacatctcagacctgatgttgtgtgcgggacgggaggagggcggcacc
gacacctgccagggcgactcgggaggtcctctgatgatcctgcagaacggtcactggact
cagatcggtgtgacatcattcggcgatggctgtggagaccctcagagtcccggagtctac
gcccgagtctccgccttcacttcctggatcactcagatgcaacgctcgcacggctaa

DBGET integrated database retrieval system