KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110175010
Entry
110175010         CDS       T05002                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec00230  Purine metabolism
bpec00240  Pyrimidine metabolism
bpec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110175010
   00240 Pyrimidine metabolism
    110175010
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110175010
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_17 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 110175010
NCBI-ProteinID: XP_020796783
Position
Unknown
AA seq 260 aa
MATPPKRARSSGARRKHLKVSIEGNIAAGKSTFVRLLEQTSDDWEVIPEPIAKWCNVHTD
KEDIYEELSSSQKSGGNLLQMLYSKPTRWSYTFQSYACLSRVRSQLQPPSLKLQESDRPV
QFYERSVYSDRYVFASTLFENQSLTETEWSVYQDWHQWTLDQFSPDLNLDAIVYLRAEPE
RCIQRLLHRGREEEQDIPLEYLQQLHLKHEAWLYHRTLRLDFEYLNHIPILVLDVNQDFK
NDRILQHGLMDQVKDFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgactcccccgaagagagcgcggagctccggagcccgcagaaaacacctcaaagtc
tccatcgagggaaacatcgcagcaggaaagtcgacgtttgtgcgactcctggagcagacg
agtgacgactgggaggtgattccagagcccatcgccaagtggtgcaacgtgcacacggac
aaagaggatatatatgaggagttgagctcttctcagaaaagtggagggaacctgctgcag
atgctctacagtaaacccacacgctggtcctacaccttccagtcgtacgcgtgcctgagc
agagttcgctctcagctgcagcctccgtctctcaaactacaagaatctgaccgaccagtg
cagttctacgagagatctgtgtactctgacaggtacgtgtttgcctctactctgttcgag
aaccagagcctgacagagactgagtggtccgtgtatcaggactggcaccagtggaccctg
gaccagttcagcccagacttaaacctggacgccatcgtgtacctgagggcagagccagag
aggtgtatacagaggctactgcacagaggccgagaggaggagcaggacattcctctggag
tatctccaacagctgcaccttaaacacgaggcctggctctaccacaggacgctcaggctg
gactttgagtatctgaaccacatccccattttagtcctggacgtgaaccaggacttcaag
aacgaccggatcctccagcacggactgatggaccaggtcaaagacttcctgtccacactt
tag

DBGET integrated database retrieval system