KEGG   Bordetella pertussis 18323: BN118_1198Help
Entry
BN118_1198        CDS       T02296                                 

Definition
(GenBank) putative tryptophan oxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00380  Tryptophan metabolism
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BN118_1198
Enzymes [BR:bper01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BN118_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase FliS IDO YfdX TPR_10
Motif
Other DBs
NCBI-ProteinID: CCJ62623
UniProt: A0A0T7CLY3
Position
complement(1300125..1300979)
Genome map
AA seq 284 aa AA seqDB search
MQPTPTQRPEAIVHDEKAQLDFARDMSYGDYLHLDELLGAQHPLSPEHNEMLFIVQHQTS
ELWMKLMLHELRAAIAAIQQDRLQPAFKMLARVSKILEQLVSAWDVLATMTPPEYSALRP
YLAHSSGFQSYQYRQIEYLLGNKNAAMLQPHAHRADLLAQVRAAFEAPSLYDEALRFLAR
SGLAVPAGALQRDWTQPYRADDQVEQAWLTVYRQSERYWNQYQLGEKLTDLEDAFRLWRF
RHVTTVERIIGFKRGTGGTSGVTYLRKMLEVVLFPEIWKLRTDL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccacccctacgcaacgccccgaagccatcgtgcacgacgaaaaagcccagctc
gatttcgcgcgcgacatgagttatggcgactacctgcacctggacgaactcctgggcgcc
cagcacccgctctcgcccgagcacaacgaaatgctgttcatcgtgcagcaccagaccagc
gagctgtggatgaagctgatgctgcacgaactgcgcgcggcgatcgccgcgatccagcag
gaccgcctgcagccggcgttcaagatgctggcgcgtgtcagcaagatcctggagcaactg
gtgtcggcctgggatgtgctggccaccatgacaccgcccgaatactcggccctgcgcccc
tacctcgcgcactccagcggcttccagagctatcagtaccgccagatcgaatacctgctg
ggcaacaagaacgccgcgatgctgcagccccacgcccaccgcgccgacctgctggcgcag
gtacgcgccgccttcgaggcgccctcgctgtacgacgaggcgctgcggttcctggcccgc
agcggcctggccgtgccggccggcgcgctgcagcgcgactggacccagccctaccgggcc
gacgaccaggtcgaacaggcctggctgaccgtctaccggcaatccgagcgctactggaac
caataccagctgggcgaaaagctgaccgacctggaagacgccttccgcctgtggcgtttt
cgccacgtgaccacggtggagcgcatcatcggcttcaagcgcggcaccggcggcacctcc
ggcgtcacttacctgcgcaagatgctggaggtggtgctgtttccggaaatctggaaattg
aggacggatctctga

DBGET integrated database retrieval system