KEGG   Bordetella pertussis 18323: BN118_1707Help
Entry
BN118_1707        CDS       T02296                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00071  Fatty acid degradation
bper00072  Synthesis and degradation of ketone bodies
bper00280  Valine, leucine and isoleucine degradation
bper00310  Lysine degradation
bper00362  Benzoate degradation
bper00380  Tryptophan metabolism
bper00620  Pyruvate metabolism
bper00630  Glyoxylate and dicarboxylate metabolism
bper00640  Propanoate metabolism
bper00650  Butanoate metabolism
bper00900  Terpenoid backbone biosynthesis
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01120  Microbial metabolism in diverse environments
bper01130  Biosynthesis of antibiotics
bper01200  Carbon metabolism
bper01212  Fatty acid metabolism
bper02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN118_1707
   00630 Glyoxylate and dicarboxylate metabolism
    BN118_1707
   00640 Propanoate metabolism
    BN118_1707
   00650 Butanoate metabolism
    BN118_1707
  Lipid metabolism
   00071 Fatty acid degradation
    BN118_1707
   00072 Synthesis and degradation of ketone bodies
    BN118_1707
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN118_1707
   00310 Lysine degradation
    BN118_1707
   00380 Tryptophan metabolism
    BN118_1707
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN118_1707
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN118_1707
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN118_1707
Enzymes [BR:bper01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN118_1707
Exosome [BR:bper04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN118_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ63132
UniProt: A0A0T7CKW3
Position
1871992..1873188
Genome map
AA seq 398 aa AA seqDB search
MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASAGIEPRAIEAAWYSSHYDD
IGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKD
TGFAGLPLASRGTLAPMYLPTHSNPGNFAQLARAYQARHGVAREDLKAAMAHTSMKSHAN
ALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRGPLV
LVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSIT
ELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGRKCFGHPVGASGLRMLYEAWLQ
LSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatcaaggatcgcgtcgccattctggcgatgggctgttcccgtttcggc
gaacgctgggacgtgggccaggaagaattgatggtcgaggcctacgccgaggcgctcgcg
agcgccggcatcgagccgcgcgccatcgaggcggcctggtactcgtcgcactatgacgac
atcggcgcgggcaaggccggcacgcccatggccatggccctgcgcctgcccgacatcggc
gtgacgcgcgtggagaacttctgcgccggcggcaccgaggcgtttcgcggcgccgtctac
gcggtcgcctccggcgccgcggacatcgcgctggcgctcggggtggaaaagctgaaagac
accggcttcgccggtctgccgctggcctcgcgcggcacgctggcgcccatgtacctgccc
acgcacagcaacccgggcaacttcgcgcagctggcccgtgcctaccaggcccgccacggc
gtggcccgggaggacctcaaggcggccatggcccatacctcgatgaaaagccatgccaac
gccttgcacaatcccaaggcgcacctgcgcaaggccatcagccgcgaacaggccgccggc
gcgccgctggtggccgaccccatcggactgttcgattgctgtccggtgtcggacggcgcc
gcctgcgccatcgtcaccacccccgagatcgcccgcagcctgaaccgcggcccgctggtc
ctggtcaaggccatccagctggccacgtccaacggctgggagctgcagcaatcggactgg
gacggctcgtacgtgcacaccacccgcgtggcggcgcgcaaggcgtacgccgaagcgggc
atcgacgatccgcgcgcgcagctcagcctgaccgaattgcacgactgcttctcgatcacc
gaactggtgacgctggaggacatcggcctggccgagcccggcacggcctggcgcggcatg
ctcgacggccgcttcgatgccgacggggcgctgccctgccagatagacggcggccggaaa
tgcttcggccatcccgtgggggcctcggggctgcgcatgctctacgaggcctggctgcaa
ctgagcggccgcgccggcgcgcgccagctgcccgcgccctcgctggccctgacccacaat
ctgggcggcgcgcccgcgcagaacgtgtgttcgatcacaatactcggcgcggcttga

DBGET integrated database retrieval system