KEGG   Bordetella pertussis 18323: BN118_2569Help
Entry
BN118_2569        CDS       T02296                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bper  Bordetella pertussis 18323
Pathway
bper00020  Citrate cycle (TCA cycle)
bper00190  Oxidative phosphorylation
bper00650  Butanoate metabolism
bper01100  Metabolic pathways
bper01110  Biosynthesis of secondary metabolites
bper01120  Microbial metabolism in diverse environments
bper01130  Biosynthesis of antibiotics
bper01200  Carbon metabolism
Module
bper_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bper_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bper_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bper00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN118_2569 (sdhD)
   00650 Butanoate metabolism
    BN118_2569 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN118_2569 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Bap31 CybS
Motif
Other DBs
NCBI-ProteinID: CCJ63994
UniProt: A0A0T7CQP2
Position
complement(2802466..2802849)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system