KEGG   Bordetella pertussis 18323: BN118_2575Help
Entry
BN118_2575        CDS       T02296                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
bper  Bordetella pertussis 18323
Pathway
bper00640  Propanoate metabolism
bper01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN118_2575 (acnA)
Enzymes [BR:bper01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BN118_2575 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C TetR_C_3
Motif
Other DBs
NCBI-ProteinID: CCJ64000
UniProt: A0A0T7CNH6
Position
2807897..2810590
Genome map
AA seq 897 aa AA seqDB search
MPRRVRHAGPARPARPPQPRFPACLHAHRDTPVMNTKYRKNLPGTSLDYFDARQAVEDLQ
AGAWATLPYTSRVLAENLVRRCDPATLSDSLRQLIERRRDMDFPWYPARVVCHDILGQTA
LVDLAGLRDAIADAGGDPAQINPVVPTQLIVDHSLAVEYPGFDKDAFEKNRAVEDRRNED
RFHFINWTKLAFRNVDVIPPGNGIMHQINLEKMSPVVQVRDGMAFPDTCVGTDSHTPHVD
ALGVIAIGVGGLEAENVMLGRASWMRLPDIVGVELTGRPQAGITCTDIVLALTEFLRREK
VVGAYLEFLGEGASALTIGDRATISNMTPEFGATAAMFYIDGQTTDYLTLTGREDSQVKL
VETYARQAGLWADDLAGAQYERMLRFDLSSVVRNMAGPSNPHKRVATTELAERGIAGPWQ
ETPGQMPDGAVIIAAITSCTNTSNPRNVIAAALLARNANRAGLTRKPWVKSSLAPGSKAV
QLYLEEAGLLPDLEKLGFGIVAFACTTCNGMSGALDPKIQQEIIERDLYATAVLSGNRNF
DGRIHPYAKQAFLASPPLVIAYAIAGTVRFDIEKDALGVDAAGKPVTLKDIWPSDAEIDA
VVTASVKPEQFRKVYEPMFRFAQEQTGKIDPLYAWRPQSTYIRRPPYWEGALAGERTLEG
MRPLAVLGDNITTDHLSPSNAIMADSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATF
ANPKLINEMAVVDGQVKQGSLARLEPEGKVMRMWETIETYMDRKQPLIIIAGADYGQGSS
RDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFQAGVDRKTLGIDGTETFDVVG
ERVPRATLTLVIHRRDGEQVQVPVICRLDTAEEVSIYEAGGVLQRFAQDFLESTQTA
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgccgggtccgccatgccggcccggcgcggccggcccggcccccgcagccccgc
tttccggcctgcctgcatgcccatagagacacgcctgtcatgaacacgaaataccgcaag
aatctgcccggtacgtcgctggactatttcgacgcccgccaggcggtcgaagacctccag
gccggcgcctgggccacgctgccctatacctcgcgcgtcctggccgagaatctggtgcgc
cgctgcgaccccgccacgctgtccgactcgctgcggcagctgatcgagcgccgccgcgac
atggacttcccctggtaccctgctcgcgtggtgtgccacgacatcctgggccagacggcg
ctggtcgacctggccggcctgcgcgacgcgattgccgacgccggcggcgacccggcgcag
atcaacccggtggtgcccacgcaactcatcgtggaccactctctggcggtcgagtacccg
ggcttcgacaaggacgccttcgagaagaaccgcgcggtggaagaccggcgcaacgaagac
cgcttccacttcatcaactggaccaagctggccttccgcaacgtggatgtgatcccgccg
ggcaacggcatcatgcaccagatcaacctggagaagatgtctccggtggtgcaagtgcgc
gacggcatggcctttccggacacctgcgtgggcaccgacagccacaccccgcacgtcgac
gccctgggcgtgatcgccatcggcgtgggcggcctggaggccgaaaacgtgatgctcggg
cgcgcttcctggatgcgcctgccggacatcgtcggcgtggagctgaccggccggccgcaa
gccggcattacctgcaccgacatcgtgctggcgctgaccgaattcctgcgccgcgaaaag
gtggtgggcgcctacctcgaattcctgggcgaaggcgccagcgcgctgaccatcggcgac
cgcgccacgatttccaacatgaccccggaattcggggcgacggccgcgatgttctatatc
gacggccagaccaccgactacctcaccctgaccggccgcgaagacagccaggtcaagctg
gtggaaacctatgccaggcaggccggactgtgggccgacgacctggcgggcgcgcagtac
gaacgcatgctgcgcttcgacctgtcgtcggtcgtgcgcaacatggccggcccctccaac
ccgcacaagcgggtggccaccaccgaactggccgaacgcggcattgccgggccgtggcag
gaaacgccgggacagatgcccgacggcgcggtgatcatcgccgccatcaccagctgcacc
aacaccagcaacccgcgcaacgtcatcgccgccgcgctgctggcgcgcaacgccaaccgc
gccggcctgacgcgcaagccgtgggtcaagagctcgctggcgccgggctcgaaggcggtc
cagctttacctggaagaagccggcctgctgcccgacctggaaaaactgggtttcggcatc
gtggctttcgcctgcacgacctgtaacggcatgagcggcgcgctcgacccgaagatccag
caggaaatcatcgagcgcgatctctatgccaccgccgtgctgtcgggcaaccgcaacttc
gacggccgcatccacccgtacgccaagcaggccttcctggcatcgccgccgctggtgatc
gcctacgccatcgccggcaccgtgcgcttcgacatcgagaaggacgcgctaggcgtggac
gccgcgggcaagcccgtgacgctcaaggacatctggcccagcgatgcggaaatcgatgcg
gtggtgacggccagcgtcaagcccgagcagttccgcaaggtctacgagccgatgttccgc
ttcgcgcaggaacagaccggcaagatcgatccgctctacgcctggcgcccgcaaagcacc
tacatccgccgcccgccctattgggaaggcgcgctggccggggagcgcacgctcgagggc
atgcgcccgctggccgtactgggcgacaacatcaccaccgaccacctctcgccatccaac
gccatcatggccgatagcgcggcgggcgagtacctggccaagatgggcctgccggaagag
gatttcaactcgtacgccacccaccgcggcgaccacctgaccgcgcagcgcgccaccttc
gccaatccgaagctgatcaacgaaatggccgtggtcgacggccaggtcaagcaaggctcg
ctcgcgcggctggagcccgagggcaaggtcatgcgcatgtgggaaaccatcgaaacctac
atggaccgcaagcagccgctgatcatcatcgccggcgccgattacggccagggctcgtcg
cgcgactgggcggccaagggcgtgcggctggccggcgtggaggccatcgtcgccgagggc
ttcgagcgcatccaccgcaccaacctgatcggcatgggcgtgctgccgctggagttccag
gcgggcgtcgatcgcaagacgctgggcatcgacggcaccgaaacctttgatgtcgtcggc
gaacgcgtgccgcgcgccacgctgacgctggtcatacaccgccgcgacggcgagcaagtg
caagtgccggtcatctgtcgcctggacaccgccgaggaagtctcgatctacgaggctggc
ggcgtgctgcagcgatttgcccaggatttcctggagtccacgcagacggcctga

DBGET integrated database retrieval system