KEGG   Bordetella pertussis 18323: BN118_3006Help
Entry
BN118_3006        CDS       T02296                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bper  Bordetella pertussis 18323
Pathway
bper03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bper00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN118_3006 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bper03011]
    BN118_3006 (rplV)
Ribosome [BR:bper03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN118_3006 (rplV)
  Bacteria
    BN118_3006 (rplV)
  Archaea
    BN118_3006 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: CCJ64431
UniProt: A0A0T7CS07
Position
complement(3285421..3285750)
Genome map
AA seq 109 aa AA seqDB search
METTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFSPKKAAVILKKAVESAIANAEH
NDGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactactgccattatccgtggtgttcacatctcggctcagaagacccgtctggtt
gcggacctgatccgcggcaagtcggtggctcaagccctgaacatcctcaccttctcgccc
aagaaggccgccgtcatcctgaagaaggctgtcgagtcggctatcgccaacgccgagcac
aacgacggcgccgatatcgacgagttgaaggtcaccaccatttttgtggacaaggctcaa
tcgatgaagcgtttctcggctcgcgccaagggccgcggtaaccgtatcgagaagcagacc
tgccatatcacggtcaaggtcggagcttaa

DBGET integrated database retrieval system