KEGG   Bordetella pertussis B1917: B1917_0643Help
Entry
B1917_0643        CDS       T03638                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00630  Glyoxylate and dicarboxylate metabolism
bpet00660  C5-Branched dibasic acid metabolism
bpet01100  Metabolic pathways
bpet01120  Microbial metabolism in diverse environments
bpet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B1917_0643
   00660 C5-Branched dibasic acid metabolism
    B1917_0643
Enzymes [BR:bpet01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     B1917_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AIW91160
Position
complement(663041..664276)
Genome map
AA seq 411 aa AA seqDB search
MKPMQQDVPPIRIEAVRVTAGIGGHWINDQMAVQTGATADGYFFEGPTSSTAFPAVRSPS
VAYLVSLDLADGQTAHGDCTTVANAGYAGRPLPLRREDVQAVQAVLQESLAGRSFAGFRE
AAGALDAMPLADTLRLPVEYGVSQALLEAAALASRTRMVDVLCREFGRPGPTRGPGFAGS
CGGAWEANVDKAIVRGLDMFPQSAIQSRAECERLPDYAAWIAGRIRKLGAAGYRPDLHFD
FHSSLGRMLDNDEDRVLDYLATICERAAGLTVFFEDPMLSGSAAEARERMGSLRAKLDAR
LPNARLIADEWANGPGNVRAFAASGAAHAVQIKMPDNGSLLTTIDAIQGCQEHGTLAYLG
GSCNETDISSRASIHVGLAFGAWRMLTKPGLGFDEGLMIMTNEISRTLSKR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatgcagcaggacgttccccccatccgtatcgaagccgtgcgcgtgacggcg
ggcatcggcggccactggatcaacgaccagatggcggtgcagaccggcgccacggccgac
ggctacttcttcgaaggcccgaccagctcgacggcctttccggcggtgcgctcgcccagc
gtggcctacctggtcagcctggacctcgccgacgggcagacggcccatggcgactgcacc
acggtggccaacgccggctatgccgggcgccccctgcccctgcggcgcgaggatgtccag
gccgtgcaggccgtgctgcaggaaagcctggccgggcgcagcttcgccggtttccgcgag
gccgccggcgccctggacgccatgccgctggccgatacgctgcgcctgccggtcgagtac
ggcgtgagccaggcgctgctggaagcggcggcgctggccagccgcacccggatggtggac
gtgctgtgccgcgaattcggtcgccccggccccacccgcgggccgggttttgccggatca
tgcggcggcgcgtgggaggccaatgtggacaaggccatcgtgcgcggcctggacatgttc
ccgcaatcggccatccagagccgcgccgagtgcgaacgcctgccggattacgccgcctgg
atcgccgggcgcatccgcaagctgggcgccgcgggctaccggcccgacctgcatttcgat
ttccattcctcgctgggacggatgctggacaacgacgaggaccgcgtcctcgactatctg
gccaccatctgcgagcgcgcggccgggctgaccgtcttcttcgaggatcccatgctgtcg
ggcagcgccgccgaggcccgcgagcggatgggctcgctgcgcgccaagctggatgcgcgc
ctgcccaatgcccgcctgatcgccgacgaatgggccaacgggccgggcaacgtgcgggcg
ttcgccgcatcgggcgcggcccatgccgtgcagatcaagatgccggacaacggctcgctg
ctgaccaccatcgacgccatccagggctgccaggagcacggcacgctggcctacctgggt
ggcagctgcaacgaaaccgacatctcgtcgcgcgcctccatccacgtgggcctggcgttc
ggcgcctggcgcatgctgaccaagcctggcctgggcttcgacgaaggcctgatgatcatg
accaacgaaatcagccgcaccttgagcaaacgctga

DBGET integrated database retrieval system