KEGG   Bordetella pertussis B1917: B1917_0691Help
Entry
B1917_0691        CDS       T03638                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00360  Phenylalanine metabolism
bpet01100  Metabolic pathways
bpet01120  Microbial metabolism in diverse environments
bpet01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    B1917_0691
Enzymes [BR:bpet01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     B1917_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 NAD_binding_8 Thi4 FAD_binding_2 Pyr_redox HI0933_like Lycopene_cycl Pyr_redox_3 FAD_oxidored UDPG_MGDP_dh_N Hemopexin NAD_binding_7 GIDA Glu_dehyd_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIW91202
Position
complement(714338..716017)
Genome map
AA seq 559 aa AA seqDB search
MGDIDYQAIEFAYTKCADQQRDTPARHCVIVVGAGPVGLTTALDLARQGLRVVVLDDDYR
LSTGSRAICFAKRTLEIWDRLGVGQRMVDKGVSWNVGKVFFRDQEVWRFDLLPEPGHRRP
AFINLQQYYAEGYLHELASAQPGIELRWKSKVVGVAQQADGVQVTVDTPDGAYALHADWL
VACDGARSPVRKLLDLETHGRVFKDRFLIADVKMAADYPAERWFWFDPPFHPNQSVLLHM
QPDNVWRIDFQLGWNADPVEAVKPENVLPRIRALLGPDADFELEWVSVYTFACERMDHFR
HGRVVFAGDSAHRVSPFGARGANSGVQDAENLAWKLKLVLAGHAPESLIDSYAAEREYAA
DENILNSSRSTDFITPKSEVSRTFRNAVLNLARQHPFARTLVNSGRLSVPAAYADSPLNT
PDSDPYAGTMRPGAVALDAPVRADAQPGWWLSQLDGGFALALFCGAETPRADMLDALRAL
QQDEVPVQPILVCDAGAAPAAAPAGVRVVEDSEGWLARRYDARPGTCYLIRPDQHIAARF
RAFDAQAVRRALARAIGRA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgggagacatcgactaccaggcgatcgagttcgcctatacgaaatgcgccgaccagcag
cgcgacacgccggcccggcactgtgtgatcgtggtgggcgcgggcccggtgggcctgacc
acggcgctggacctggcgcggcaaggcctgcgggtcgtggtgctggatgacgactaccgc
ctgtcgaccggctcgcgcgccatctgcttcgccaagcgcacgctggagatctgggaccgc
ctgggcgtgggccagcgcatggtcgacaagggcgtatcgtggaacgtcggcaaggtgttc
ttccgcgaccaggaagtctggcgcttcgacctgctgcccgagcccgggcaccggcgcccg
gccttcatcaacctgcagcagtattacgccgagggctacctgcacgaactggccagcgcc
cagccgggcatcgagctgcgctggaaaagcaaggtggtgggcgtggcgcagcaggccgat
ggcgtgcaggtcacggtcgacacgcccgacggcgcctacgccctgcatgccgactggctg
gtcgcctgcgacggcgcgcgctcgccggtgcgcaagctgctggacctggaaacccatggc
cgggtattcaaggaccgcttcctgatcgccgacgtgaagatggcggccgattatcccgct
gagcgctggttctggttcgacccgcccttccaccccaatcagtcggtcctgctgcacatg
cagcccgacaatgtctggcgcatcgatttccagctgggctggaacgccgaccctgtcgag
gccgtcaagcccgagaacgtgctgccgcgcatccgcgccctgctgggcccggacgccgac
ttcgaactggagtgggtgagcgtctacaccttcgcctgcgagcgcatggaccatttccgc
catgggcgcgtggtgttcgccggcgattcggcccaccgcgtctcgccgttcggcgcgcgc
ggcgccaatagcggcgtgcaggacgccgagaacctggcctggaagctgaagctggtgctg
gcgggccacgcccccgaatcgctgatcgacagctacgccgccgaacgcgaatacgccgcc
gacgagaacatcctgaattcgtcgcgctcgaccgacttcatcacgcccaagagcgaagtc
agccgcaccttccgcaacgccgtgctcaacctggcgcgccagcatccgttcgcgcgcacg
ctggtcaacagcggccgcctgtcggtgccggccgcctacgccgactcgccgctgaacacg
cccgacagcgacccctatgccggcacgatgcggccgggcgccgtggcgctggacgcgccc
gtacgggcggacgcgcagcccggctggtggctgtcccagctcgatggcgggttcgcgctg
gcgctgttctgcggcgccgagacgccgcgggccgatatgctggacgcgctgcgggcactg
cagcaggacgaggtgcccgtgcagcccatcctggtctgcgacgcgggcgccgcgccggcc
gccgcgcccgcaggggtgcgcgtggtcgaggacagcgaaggctggctggcccgccgctac
gacgcccggcccggcacctgctacctgatccgccccgaccaacacattgcggcgcgcttt
cgcgccttcgacgcccaggccgtccggcgggcgctggcgcgcgccatcggccgcgcgtaa

DBGET integrated database retrieval system