KEGG   Bordetella pertussis B1917: B1917_1838Help
Entry
B1917_1838        CDS       T03638                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00071  Fatty acid degradation
bpet00072  Synthesis and degradation of ketone bodies
bpet00280  Valine, leucine and isoleucine degradation
bpet00310  Lysine degradation
bpet00362  Benzoate degradation
bpet00380  Tryptophan metabolism
bpet00620  Pyruvate metabolism
bpet00630  Glyoxylate and dicarboxylate metabolism
bpet00640  Propanoate metabolism
bpet00650  Butanoate metabolism
bpet00900  Terpenoid backbone biosynthesis
bpet01100  Metabolic pathways
bpet01110  Biosynthesis of secondary metabolites
bpet01120  Microbial metabolism in diverse environments
bpet01130  Biosynthesis of antibiotics
bpet01200  Carbon metabolism
bpet01212  Fatty acid metabolism
bpet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpet00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1917_1838
   00630 Glyoxylate and dicarboxylate metabolism
    B1917_1838
   00640 Propanoate metabolism
    B1917_1838
   00650 Butanoate metabolism
    B1917_1838
  Lipid metabolism
   00071 Fatty acid degradation
    B1917_1838
   00072 Synthesis and degradation of ketone bodies
    B1917_1838
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1917_1838
   00310 Lysine degradation
    B1917_1838
   00380 Tryptophan metabolism
    B1917_1838
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1917_1838
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1917_1838
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B1917_1838
Enzymes [BR:bpet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1917_1838
Exosome [BR:bpet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1917_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIW92215
Position
1955962..1957149
Genome map
AA seq 395 aa AA seqDB search
MNEVVVVVVAAARTAIGDFGGGLKDVAPCDLGATVIREALARAGVAGPEVGHVAVGHVIN
TEPRDMYLSRVAAINAGIGKETPAFNVNRLCGSGLQAIVSAAQTIMLGDTEIAVGAGAES
MSRAPYIAPAQRWGARMGDSAMVDMMTGALSDPFGRMHMGVTAENVAARYSISRADQDAL
AVESHRRAAAAIDAGRFRDQIVPVTLKTRKGETVFDTDEHVRRDITIEGMAALRPVFQKE
NGTVTAGNASGLNDGAGAVVLMSAAAAAQRGIAPMARLVAYAHAGVDPEIMGIGPVPATQ
AALKRAGLTVDQLDVIEANEAFAAQACAVTRQLELDPAKVNPNGSGISLGHPIGATGAII
TVKALYELQRVGGRYALVTMCIGGGQGIAAIFERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgtagtcgtagtcgtagccgctgcccgtaccgccattggcgatttcggc
ggcggcctgaaagacgtggcgccctgcgacctgggcgccacggtcatccgggaagcgctg
gcgcgcgccggcgtggccggccccgaggtcggccacgtcgccgtcggccatgtcatcaac
accgagccgcgcgacatgtacctgtcccgcgtggccgcgatcaacgccggtatcggcaag
gaaaccccggcgttcaacgtcaaccgcctgtgcgggtcggggctgcaggcgatcgtgtcg
gccgcccagaccatcatgctgggcgataccgagatcgccgtgggcgcgggcgccgaaagc
atgagccgcgcgccgtatatcgccccggcgcagcgctggggcgcgcgcatgggcgacagc
gccatggtcgacatgatgaccggcgcgctgtccgatccgtttggccgcatgcacatgggc
gtgacggccgagaacgtggcggcgcgctattccatcagccgcgccgaccaggacgcgctg
gcggtcgagtcgcatcgccgcgccgcggccgccatcgacgcgggccgctttcgcgaccag
atcgtcccggtgacgttgaagacgcgcaagggcgagacagtgttcgacaccgacgagcac
gtgcgccgcgacatcaccatcgaaggcatggcggccctgcggccggtgttccagaaggaa
aacggcacggtcacggcgggcaacgcgtcgggcctgaacgacggcgcgggggcggtggtg
ctgatgagcgcggccgcggcggcgcagcgcggcatcgcgccgatggcgcgcctggtggcc
tatgcgcatgccggcgtggaccccgagatcatgggcatcggcccggtgccggccacgcag
gccgcgctcaagcgcgctggcctgaccgtcgaccagctcgacgtgatcgaggccaacgag
gcgttcgccgcgcaggcctgcgcggtgacgcgccagctggagctggatcccgccaaggtc
aatccgaacggcagcggcatcagcctgggccatcccatcggcgcgaccggggccatcatc
acggtcaaggccttgtacgagttgcagcgcgtgggcggccgctacgcgctggtgacgatg
tgcatcggcggcgggcagggcatcgccgccattttcgagcgcgtctga

DBGET integrated database retrieval system