KEGG   Bordetella pertussis B1917: B1917_1877Help
Entry
B1917_1877        CDS       T03638                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00071  Fatty acid degradation
bpet00072  Synthesis and degradation of ketone bodies
bpet00280  Valine, leucine and isoleucine degradation
bpet00310  Lysine degradation
bpet00362  Benzoate degradation
bpet00380  Tryptophan metabolism
bpet00620  Pyruvate metabolism
bpet00630  Glyoxylate and dicarboxylate metabolism
bpet00640  Propanoate metabolism
bpet00650  Butanoate metabolism
bpet00900  Terpenoid backbone biosynthesis
bpet01100  Metabolic pathways
bpet01110  Biosynthesis of secondary metabolites
bpet01120  Microbial metabolism in diverse environments
bpet01130  Biosynthesis of antibiotics
bpet01200  Carbon metabolism
bpet01212  Fatty acid metabolism
bpet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1917_1877
   00630 Glyoxylate and dicarboxylate metabolism
    B1917_1877
   00640 Propanoate metabolism
    B1917_1877
   00650 Butanoate metabolism
    B1917_1877
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1917_1877
   00072 Synthesis and degradation of ketone bodies
    B1917_1877
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1917_1877
   00310 Lysine degradation
    B1917_1877
   00380 Tryptophan metabolism
    B1917_1877
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1917_1877
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1917_1877
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1917_1877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpet04147]
    B1917_1877
Enzymes [BR:bpet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1917_1877
Exosome [BR:bpet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1917_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIW92249
Position
complement(1997855..1999051)
Genome map
AA seq 398 aa AA seqDB search
MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASAGIEPRAIEAAWYSSHYDD
IGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKD
TGFAGLPLASRGTLAPMYLPTHSNPGNFAQLARAYQARHGVAREDLKAAMAHTSMKSHAN
ALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRGPLV
LVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSIT
ELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGRKCFGHPVGASGLRMLYEAWLQ
LSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatcaaggatcgcgtcgccattctggcgatgggctgttcccgtttcggc
gaacgctgggacgtgggccaggaagaattgatggtcgaggcctacgccgaggcgctcgcg
agcgccggcatcgagccgcgcgccatcgaggcggcctggtactcgtcgcactatgacgac
atcggcgcgggcaaggccggcacgcccatggccatggccctgcgcctgcccgacatcggc
gtgacgcgcgtggagaacttctgcgccggcggcaccgaagcgtttcgcggcgccgtctac
gcggtcgcctccggcgccgcggacatcgcgctggcgctcggggtggaaaagctgaaagac
accggcttcgccggtctgccgctggcctcgcgcggcacgctggcgcccatgtacctgccc
acgcacagcaacccgggcaacttcgcgcagctggcccgtgcctaccaggcccgccacggc
gtggcccgggaggacctcaaggcggccatggcccatacctcgatgaaaagccatgccaac
gccttgcacaatcccaaggcgcacctgcgcaaggccatcagccgcgaacaggccgccggc
gcgccgctggtggccgaccccatcggactgttcgattgctgtccggtgtcggacggcgcc
gcctgcgccatcgtcaccacccccgagatcgcccgcagcctgaaccgcggcccgctggtc
ctggtcaaggccatccagctggccacgtccaacggctgggagctgcagcaatcggactgg
gacggctcgtacgtgcacaccacccgcgtggcggcgcgcaaggcgtacgccgaagcgggc
atcgacgatccgcgcgcgcagctcagcctgaccgaattgcacgactgcttctcgatcacc
gaactggtgacgctggaggacatcggcctggccgagcccggcacggcctggcgcggcatg
ctcgacggccgcttcgatgccgacggggcgctgccctgccagatagacggcggccggaaa
tgcttcggccatcccgtgggggcctcggggctgcgcatgctctacgaggcctggctgcaa
ctgagcggccgcgccggcgcgcgccagctgcccgcgccctcgctggccctgacccacaat
ctgggcggcgcgcccgcgcagaacgtgtgttcgatcacaatactcggcgcggcttga

DBGET integrated database retrieval system