KEGG   Bordetella pertussis B1917: B1917_2558Help
Entry
B1917_2558        CDS       T03638                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00564  Glycerophospholipid metabolism
bpet01100  Metabolic pathways
bpet01110  Biosynthesis of secondary metabolites
Module
bpet_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1917_2558 (psd)
Enzymes [BR:bpet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     B1917_2558 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AIW92858
Position
2714701..2715594
Genome map
AA seq 297 aa AA seqDB search
MPFKDQLFLASQYLAPHHLVSRLMGRVADCRAPEIKNRMIARFVRRYNVDMSEALVEDPL
AYASFNDFFTRALKPDARPLDDEPGAALCPADGAISQIGAIDNGRIFQAKGHSFGLTDLL
GGDAERAAPFAGGQFATIYLSPRDYHRVHMPLAGTLREMVHVPGRLFSVNPLTARSVPEL
FARNERVACLFDTEHGPMALVLVGAMIVASIETVWAGLVTPHKRQVRSVRYDAAARAPIH
LDKGAEMGRFKLGSTVIVLFGPKRLRWLDLPSVRGPVRMGETLALPASTAISFPESE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaaagaccagctttttctcgccagccagtatctcgctccgcatcacctggtc
tcgcgcctgatgggccgcgtggcggattgccgcgcccccgaaatcaagaaccgcatgatt
gcgcgcttcgtacgccgctacaacgtcgacatgagcgaagccctggtcgaggacccgctg
gcctacgccagcttcaacgacttcttcacgcgcgcgctcaagccggacgcccgcccgctg
gacgacgagcccggcgcggcgctgtgcccggccgacggcgccatcagccagatcggcgcc
atcgacaacggccgcatcttccaggccaagggccacagcttcgggctgaccgacctgctg
ggcggcgacgccgagcgcgccgcgccgtttgccggcggccagttcgccaccatctacctg
tcgccgcgcgactaccaccgcgtgcacatgcccctggccggcacgctgcgcgaaatggtg
cacgtgcccggccgcctgttttccgtgaacccgctgaccgcgcgcagcgtgccggaactg
ttcgcgcgcaacgaacgcgtggcctgcctgttcgacaccgagcatggccccatggcgctg
gtgctggtcggcgccatgatcgtcgcgtccatcgaaaccgtctgggccggcctggtgacg
ccgcacaagcgccaggtgcgcagcgtccgctacgacgccgccgcccgtgcgcccatccat
ctggacaagggcgccgaaatgggccgcttcaagctgggctccaccgtcatcgtgctgttc
ggccccaagcgcttgcgctggctggacctgccctcggtacgcgggccggtacggatgggc
gaaaccctggcattgcccgccagcaccgccatttcatttccagaaagcgaataa

DBGET integrated database retrieval system