KEGG   Bordetella pertussis B1917: B1917_3334Help
Entry
B1917_3334        CDS       T03638                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1917_3334 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpet02022]
    B1917_3334 (ompR)
Two-component system [BR:bpet02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   B1917_3334 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIW93558
Position
complement(3536900..3537634)
Genome map
AA seq 244 aa AA seqDB search
MNTQNTTPTRKILVVDDDPRLRDLLRRYLSEQGFNVFVAEDAKEMGKLWQREHFDLLVLD
LMLPGEDGLSICRRLRGGHDNTPIIMLTAKAEEIDRIVGLEMGADDYLSKPFNPRELLAR
INAILRRRGTEEHPGAPSQENESIAFGPYVLNLSTRTLTRNGEQVPITTGEFSVLKVFAR
HPKIPLSRDKLMELARGREYEAFDRSLDVQISRLRKLIEPNPSKPVFIQTVWGLGYVFVP
DGGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcaaaacaccactcctacccgcaagatcctggtcgtcgacgatgatccccga
ctgcgcgatctcctgcgccgctatctgtcggaacaagggttcaatgtattcgtggccgaa
gatgccaaggaaatgggcaaactgtggcaacgcgaacactttgacctgctggttctcgac
ctgatgctgccgggcgaggatggcctgtcgatctgccgccgcctgcgcggcggccacgac
aatactcccatcatcatgctgaccgccaaggccgaggaaatcgaccggatcgtcggcctg
gaaatgggagccgacgattacctgtccaagcccttcaacccgcgcgaactgctggcccgc
atcaatgcgatcctgcgccgccgcggcaccgaagagcacccgggcgcgcccagccaggaa
aacgagtcgatcgccttcggcccgtacgtcctgaacctgtccacgcgcaccctcacccgc
aatggcgagcaggtgccgatcacgaccggcgaattctcggtcctgaaggtttttgcccgc
catccaaagatcccgctgtcgcgcgacaagctgatggaactggcccgcggacgcgaatac
gaggcgttcgaccgcagcctggatgtgcagatttcgcgtctgcgcaaattgatcgaaccc
aacccgtccaaacccgttttcatccaaaccgtctggggcctgggatacgttttcgttccg
gatggcggcagttga

DBGET integrated database retrieval system