KEGG   Bordetella pertussis B1917: B1917_3517Help
Entry
B1917_3517        CDS       T03638                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bpet  Bordetella pertussis B1917
Pathway
bpet00220  Arginine biosynthesis
bpet00330  Arginine and proline metabolism
bpet01100  Metabolic pathways
bpet01110  Biosynthesis of secondary metabolites
bpet01130  Biosynthesis of antibiotics
bpet01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B1917_3517
   00330 Arginine and proline metabolism
    B1917_3517
Enzymes [BR:bpet01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B1917_3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AIW93728
Position
3729138..3730082
Genome map
AA seq 314 aa AA seqDB search
MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERRGLQVTDRGNLQGAPN
PWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHSLAIGSISAVARYCRAS
GRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALTSMAGRTPAIEPGWVRQI
GIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGLDPQTHLHVSFDVDFLDPE
LAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSRDIVELNPALDVRNKTAQVAVDLVESL
FGKSTLMRRRPGSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgcatcgttcccccacggggtcagcctgatcggcgcgcccaccgacatcggc
gcgggccagcgcggcgcttccatggggcccgaggccctgcgcgtggcgggcctggtgcgc
ctgctcgagcggcgcggcctgcaagtgaccgatcgcggcaacctgcagggcgcgcccaac
ccgtggcgcccgccggccaacggctaccggcacctcaacgaagtcatcggctggaaccag
ctcgtgcacgacgccgtcagcgccgagttgcgccaggagcgcctgcccatcctgctgggc
ggcgaccacagcctggccatcggctcgatcagcgcggtggcgcgctattgccgcgcgagt
ggccgcaagctgcgcgtgctgtggctggacgcgcacgccgacttcaataccaaccggctc
acgcccaccggcaacgtgcacggcatgccggtcgcctgcctgtgcggcaacggccccgcg
gcactgaccagcatggccggccgcacgccggccatcgaaccgggctgggtgcgccagatc
ggcatccgcagcgtggacgaaggcgaacgcaacctggtctacgacgccgggctggaggtc
tacgacatgcgctatctcgacgaggtcggcatgcgcgcggtgatggaggccgccctggcc
gggctggacccgcagacgcatttgcacgtcagcttcgacgtcgacttcctcgaccccgag
ctggcgccgggcgtgggcacgaccgtgcccggcggtcccacctatcgcgaagcccagctg
tgcatggaaatgatcgccgacaccggcctgatgcgctcgcgggacatcgtcgaactcaat
cccgcgctggacgtgcgcaacaagaccgcccaggtcgcggtggacctggtcgaaagcctg
ttcggcaaatccaccctgatgcgccggcgccccggcagcgcctga

DBGET integrated database retrieval system