KEGG   Bordetella pertussis 137: Q425_11400Help
Entry
Q425_11400        CDS       T03754                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00430  Taurine and hypotaurine metabolism
bpeu00460  Cyanoamino acid metabolism
bpeu00480  Glutathione metabolism
bpeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Q425_11400
   00460 Cyanoamino acid metabolism
    Q425_11400
   00480 Glutathione metabolism
    Q425_11400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpeu01002]
    Q425_11400
Enzymes [BR:bpeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Q425_11400
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Q425_11400
Peptidases and inhibitors [BR:bpeu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Q425_11400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJB25897
Position
1178830..1180458
Genome map
AA seq 542 aa AA seqDB search
MKAFNWVNPYPSTRIPVFARNVVSTSHPLAAQAGLRMLLKGGNAVDAAIAAAATIVLVEP
VSCGLGGDCFAIVWDGRQLHGLNSSGVAPAAWNVEYFKRKYGTGPDGLAVQPKRGWDAVT
VPGVVAGWAALHEKLGKLPFEQLFEPAIEIAERGYTVPPVVAHKWAAAAAELGEQPGYAQ
AFMPEGRAPRVGEHFLFPDAAYALRRIAASGGRDFYEGELAERIAAFSKECGGAMTLDDL
RNYRPEWVKPISRSYRGYELHEIPPNGQGIAALIALGICERFDLADMPVDSVQSQHLQIE
AMKLAFSDLYRYVADPRSMEVTPQQMLDDAYLDSRARLIDPDRATHFEAGRPHAGGTIYL
TAADENGMMISFIQSNYMGFGSGVVVPGTGISLQNRGVGFSMNPASANVVEGGKRPFHTI
IPGFLTRGGKPVMSFGVMGGDMQPQGHLQTVIRMLDYHQQPQAACCAPRWKVNRDFTLDI
ESTMNRATVEGLKNLGHRLKAVDDPYMDFGAGQFIWRMAESDNDLGYVAASDSRRDGQAV
GF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcaattgggtcaatccgtacccgtccacccgcattcccgtcttcgcccgc
aatgtcgtgtccacctcgcacccgctggcggcgcaggccggcctgcgtatgctgctcaag
ggcggcaacgcggtcgatgcggccatcgcggcggcggcgaccatcgtgctggtcgagccg
gtgtcctgtggactgggcggcgactgcttcgccatcgtctgggatggccggcaattgcac
ggcctgaactcgtcgggcgtggcgccggcggcgtggaatgtggagtatttcaagcgcaag
tacggcaccggcccggacgggctggccgtgcagcccaagcgcggctgggacgccgtgacc
gtgcccggcgtggtggcgggctgggccgcgctgcacgagaagctgggcaagctgccgttc
gagcagttgttcgagcccgccatcgagatcgccgagcgcggctatacggtgccgcccgtg
gtggcgcacaaatgggccgccgcggccgccgagctgggcgagcagccgggctacgcccag
gcgttcatgcccgaggggcgcgcgccgcgggtgggcgagcatttcctcttccccgacgcc
gcgtacgcgctgcgacgcatcgccgcctcgggcggacgcgacttctacgagggcgagctg
gccgagcgcatcgccgcgttcagcaaggaatgcggcggcgccatgacgctggacgatctg
cgcaattaccgccccgagtgggtcaagccgatttcccgctcctaccgcggctacgagttg
cacgagatcccgcccaacgggcagggcatcgccgcgctgatcgcgctgggcatctgcgag
cgcttcgacctggccgacatgccggtcgattcggtgcagtcgcagcatctgcagatcgag
gccatgaagctggcgttctccgacctgtaccgctatgtcgccgatccgcgcagcatggaa
gtcacgccgcagcagatgctcgatgacgcgtacctggacagccgggccaggctgatcgac
ccggaccgcgccacgcatttcgaggcggggcgtccgcatgccggcggcaccatctacctg
acggccgccgacgagaacggcatgatgatttcgttcatccagtccaactacatgggcttc
ggttcgggcgtggtcgtgccgggcaccggcatcagcctgcagaaccgcggcgtgggcttc
tcgatgaacccggcctcggccaacgtggtggaaggcggcaagcggccgttccacaccatc
atcccgggcttcctgacgcgcggcggcaagccggtcatgagctttggcgtgatgggcggc
gacatgcagccgcagggccatctgcagaccgtcatccgcatgctggactaccaccagcag
ccgcaggccgcctgctgcgcgccgcgctggaaggtcaaccgcgatttcacgctggatatc
gagtccaccatgaaccgcgcgacggtcgaggggctgaagaacctgggccaccgcctcaag
gcggtggacgacccgtacatggacttcggcgccggccagttcatctggcgcatggcggaa
agcgacaacgatctcggctacgtggcggccagcgacagccggcgcgacgggcaggccgta
ggcttctga

DBGET integrated database retrieval system