KEGG   Bordetella pertussis 137: Q425_15880Help
Entry
Q425_15880        CDS       T03754                                 

Definition
(GenBank) acyl-CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00020  Citrate cycle (TCA cycle)
bpeu00620  Pyruvate metabolism
bpeu00650  Butanoate metabolism
bpeu01100  Metabolic pathways
bpeu01110  Biosynthesis of secondary metabolites
bpeu01120  Microbial metabolism in diverse environments
bpeu01130  Biosynthesis of antibiotics
bpeu01200  Carbon metabolism
Module
bpeu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpeu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q425_15880
   00620 Pyruvate metabolism
    Q425_15880
   00650 Butanoate metabolism
    Q425_15880
Enzymes [BR:bpeu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Q425_15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AJB26294
Position
1654697..1656229
Genome map
AA seq 510 aa AA seqDB search
MSGDSMHLERIRHPGLRARLASPQEAARLVHDGMTVGMSEFTRAGDCKSVPAALAERAAA
EPLRITLLTGASLGHDTDKLLAQAGVLARRMPFQVDTTLRRKINQGEIAFVDQHLSETVE
QLRAGHIGPIDIAIVEAAAITEDGGIVPTMSVGNSASFVEQARLVIVELNLGVPAAIEGL
HDIVIPGARPGRQPLPLVSVDQRIGAPCIAVDPDKIAAIVVTNEPDSPSNALPPDEETGA
IAGHIVGFLRQEVNQGRLSRSLLPLQAGIGTIANAVLHGFGESEFEGLTMYSEVLQDSAI
ELLDQGKLSFASASSITVSLPVYERILGNLEHYRQRIVLRPQEISNAPELVRRLGVIAIN
TALEFDIYGNVNSTHVGGTHMMNGIGGSGDFVRNAHLSIFVTKSMARNGDISSVVPMVSH
VDHNEHDVDILVTECGLADLRGLAPRERARAIIAHCVHPSYRDALRDYFERACRRGGQTS
HLLEEAFSWHQRYNETDTMRLAAPAARRVA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagacagcatgcatctcgaacgtattcgccatcccggcctgcgcgcccggttg
gcttccccccaggaagcggcccggctggtccacgacggcatgaccgtcggcatgagtgag
ttcacgcgcgcgggcgactgcaaatcggtgccggcggcgctggccgaaagagccgccgcc
gagccgctgcgcatcacgctgctgaccggcgcctcgctggggcatgacaccgacaagctg
ctggcgcaggccggcgttctggcgcgccgcatgccgttccaggtcgacaccacgctgcgg
cgcaagatcaaccagggcgagatcgcctttgtcgaccagcacttgtccgaaaccgtcgag
cagttgcgcgccggccatatcggccccatcgacatcgccatcgtcgaggcggctgccatc
accgaagacggcggcatcgtgccgaccatgtcggtcggcaactcggcctcgttcgtcgag
caggcccgcctggtcatcgtcgagctcaatctcggcgtgcccgcggccatcgaaggcctg
cacgacatcgtgatcccgggcgcgcggcccggccgccagcccctgccgctggtgtcggtc
gaccagcgcatcggcgcgccctgcatcgcggtggaccccgacaagatcgccgccatcgtc
gtcaccaacgaaccggacagtccctcaaacgccttgccgcccgacgaggagaccggcgcc
atcgccggccacatcgtcggcttcctgcgccaggaagtgaaccaggggcgcctgagccgc
tcgctgctgcccctgcaggccggcatcggcacgatcgccaatgccgtgctgcacgggttc
ggcgagtcggaattcgaggggctcaccatgtactcggaagtgctgcaggacagcgcgatc
gaactcctggaccagggcaagctgagtttcgcctcggcctcgtccatcacggtctcgctg
ccggtgtacgaacgcatcctgggcaacctcgagcactaccgccagcgcatcgtgctgcgc
ccgcaggaaatcagcaacgcgcccgagctggtgcgccgcctgggcgtgattgccatcaac
acggcgctggagttcgacatctacggcaacgtcaactccacccatgtgggcggcacccat
atgatgaacggcatcggcggttcgggggactttgtgcgcaacgcgcacctgtccatcttc
gtgaccaagtccatggccaggaacggcgatatttccagcgtggtgcccatggtctcgcat
gtggaccacaacgagcacgacgtcgatatcctggtgaccgagtgcgggctggcggacctg
cgcggcctggcgccgcgcgagcgcgctcgcgccatcatcgcccattgcgtgcatccctcg
taccgcgatgcgctgcgcgattacttcgagcgcgcctgcaggcgcggcgggcaaacgtcc
catctgctggaggaggccttctcctggcaccagcgctacaacgaaaccgacacgatgcgg
ctggcggcaccggcggcccggcgcgtggcctga

DBGET integrated database retrieval system