KEGG   Bordetella pertussis 137: Q425_18960Help
Entry
Q425_18960        CDS       T03754                                 

Gene name
surE
Definition
(GenBank) stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00230  Purine metabolism
bpeu00240  Pyrimidine metabolism
bpeu00760  Nicotinate and nicotinamide metabolism
bpeu01100  Metabolic pathways
bpeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Q425_18960 (surE)
   00240 Pyrimidine metabolism
    Q425_18960 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Q425_18960 (surE)
Enzymes [BR:bpeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Q425_18960 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AJB26554
Position
1991842..1992600
Genome map
AA seq 252 aa AA seqDB search
MRILVSNDDGYNAPGLEALVEALSGLGELTVVAPETNHSGASNSLTLNRPLTVRTAANGF
IYVNGTPSDCVHVALTGLMDARPDLVVSGINNGANMGDDTLYSGTVAAASEGYLFGIPSI
AFSLIEKGWQHIESAARAARQVVERQIAQPLAAPVLLNVNIPNRRYEDMKGYAVTRLGKR
HPSEPVVRTTTPYGDTVYWVGPVGLAADATPGTDFHATAQGQVSVTPLRLDLTQHSQLDD
VRNWAEPLCVNA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattctggtttcaaacgacgatggttacaacgcccccgggctggaagcgctggtc
gaggcgctgtccgggctgggcgaactgaccgtggtcgcgccggagacgaatcacagcggc
gcctcgaactccctgaccctgaaccggccgctgacggtgcgcaccgctgccaacggcttc
atctacgtcaacggcacgccgtccgattgcgtgcacgtcgccctgaccggcctgatggat
gcgcgtcccgacctggtggtgtccggcatcaacaacggcgccaacatgggcgacgacacg
ctttattccggcacggtggccgcggccagcgagggctacctgttcggcatcccctcgatc
gccttctcgctgatcgaaaaaggctggcagcacatcgaatcggccgcgcgcgccgcccgc
caggtggtcgagcgccagatcgcgcagccgctggccgcgccggtcctgctcaacgtcaat
atccccaatcgccgctacgaggacatgaaaggctacgccgtcacgcggctgggcaagcgc
catccgtccgagccggtggtgcgtaccaccacgccttatggcgacacggtgtactgggtc
ggcccggtcggcctggccgccgacgccacgccggggacggacttccacgccacggcgcag
gggcaggtctcggtgacgccgctgcgcctggacctgacccagcacagccagcttgacgat
gtgcgcaactgggcggagccgctatgcgtaaacgcgtag

DBGET integrated database retrieval system