KEGG   Bordetella pertussis 137: Q425_22130Help
Entry
Q425_22130        CDS       T03754                                 

Definition
(GenBank) oxidoreductase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00280  Valine, leucine and isoleucine degradation
bpeu00410  beta-Alanine metabolism
bpeu00562  Inositol phosphate metabolism
bpeu00640  Propanoate metabolism
bpeu01100  Metabolic pathways
bpeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Q425_22130
   00562 Inositol phosphate metabolism
    Q425_22130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q425_22130
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q425_22130
Enzymes [BR:bpeu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Q425_22130
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Q425_22130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJB26840
Position
2311696..2313162
Genome map
AA seq 488 aa AA seqDB search
MIGGKLVQSKTTQWRDVINPATQEVVAQVPFTTREELDLAVANAKEAFKTWRNTGQGARM
RVMLKLQQLLRDNTGKLAEMITREHGKTLPDAEGEVGRGLEVVEHACSIANLQLGEYAEN
AAGGIDVYTLIQPLGVCAGITAFNFPVMLPCFMFPIAVACGNTFVLKPSEQDPSSSLFLA
QLALEAGLPPGVLNVVHGGPDIANGLCEHPDIKAVSFIGSTRVGTEIYNRASAAGKRCQS
MMGAKNHCVILPDADPEVALNQLVGAAFGAAGQRCMATSVAVMVGEARNWLPDFVERARK
LKVNNGVDREADLGPLVSPAAKQRVEGLIQKGVDEGAKLLLDGRSLKVAGFEQGNFVGPT
IFDGVTENMTIYTEEVFGPVLCVVGVDTLEDAVEFINRNPNGNGVALFTQDGGAARYFQN
NIDVGQVGINIPIPVPVAWFSFTGSRGSKLGDLGPNGKQAVQFWTQTKTVTARWSAHGRG
VNTTISMK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggcggcaagctcgtacagtccaagaccacccaatggcgcgacgtgatcaacccc
gccacccaggaggtcgtggcccaggtgccgttcaccacccgcgaagaactggacctggcc
gtcgccaacgccaaggaagccttcaagacctggcgcaataccgggcagggcgcgcgcatg
cgcgtcatgctcaagctgcagcagctgctgcgcgacaacaccggcaagctggccgagatg
atcacccgcgagcatggcaagaccctgccggatgccgagggcgaggtcggccgcggcctg
gaagtggtcgagcatgcctgctcgatcgccaacctgcagctgggcgagtacgccgagaac
gccgccggcggcatcgacgtctacacgctgatccagccgctgggcgtgtgcgccggcatc
accgcgttcaacttcccggtcatgctgccgtgcttcatgttcccgatcgcggtggcctgc
ggcaacaccttcgtgctcaagccgtcagagcaggatccctcgtcgtcgctgttcctggcc
cagctggcgctggaagccggcctgccgccgggcgtgctcaacgtggtgcacggcggcccg
gacatcgccaacggcctgtgcgagcacccggatatcaaggcggtgtcgttcatcggttcg
acccgcgtgggcaccgagatctacaaccgcgcctcggccgcgggcaagcgctgccaatcg
atgatgggcgccaagaaccactgcgtgatcctgcccgacgccgatcccgaagtggcgctc
aaccagctggtgggcgcggcgttcggcgccgccggccagcgctgcatggccacctcggtg
gcggtgatggtgggcgaggcgcgcaactggctgcccgatttcgtcgagcgcgccaggaag
ctgaaggtcaacaacggcgtcgaccgcgaggccgatctcggcccgctggtatcgcccgcg
gccaagcagcgcgtcgagggcctgatccagaagggcgtggacgagggcgccaagctgctg
ctggacggccgcagcctcaaggtggccggcttcgagcagggcaacttcgtcggcccgacc
atcttcgatggcgtgaccgagaacatgaccatctacaccgaggaagtgttcgggccggtg
ctgtgcgtggtgggcgtggacacgctggaggacgcggtcgaattcatcaatcgcaacccc
aacggcaacggcgtggcgctgttcacgcaggacggcggcgcggcgcgctacttccagaac
aacatcgacgtcggccaggtggggatcaacattcccatcccggtgccggtggcctggttc
agctttaccggctcgcgcgggtccaagctgggcgacctcgggcccaacggcaagcaggcg
gtgcaattctggacgcagacgaagacggtgacggcgcgctggtccgcccacgggcgcggc
gtgaacaccaccatctcgatgaaatga

DBGET integrated database retrieval system