KEGG   Bordetella pertussis 137: Q425_22790Help
Entry
Q425_22790        CDS       T03754                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Q425_22790
Enzymes [BR:bpeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     Q425_22790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo RIO1 APH Pkinase
Motif
Other DBs
NCBI-ProteinID: AJB26899
Position
2382766..2383500
Genome map
AA seq 244 aa AA seqDB search
MPADTRARTERLAWREAPAGAMLYDAARIEAPGPALFDPSSYGAAAQPVAAGGRQAAWFV
ATPGWQGVLRGYRCGGLAARVSRDAYVWQGEARTRGLREYRLLAHMREQGLAVPAPLAAG
YWRYGLTYRAAILVERIPAARPLASLLDEPAWEAVARAIAAMHRAGVWHADLNAFNILLD
PGGLAWLIDFDRGTAGGVSERGRQGNLARLRRSLVKVGGERGQDFWQRLEPAYRAAWARG
TARA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgccggctgatacccgggcgcgcaccgaacgcctggcctggcgcgaggcgccggccggc
gccatgctgtacgacgcggcgcgtatcgaggcgcccgggccggcgctgttcgatccgtcc
agctatggcgcggccgcgcagccggtggcggcgggcggcaggcaggcggcgtggttcgtc
gccacgcccggctggcagggtgtgctgcgcggctaccggtgcggcggcctggcggcgcgc
gtcagccgcgatgcctatgtgtggcaaggcgaggcgcgtacccgcggcctgcgcgagtac
cgcctgctggcgcacatgcgcgagcagggcctggccgtgccggcgccgctggcggccggc
tactggcgctacggcctgacgtaccgggcggcgatcctggtcgagcgcatcccggcggcc
cggccgctggccagcctgctcgacgagcccgcctgggaggcggtggcgcgcgccatcgcg
gccatgcaccgggcgggcgtctggcatgccgacctgaacgccttcaatatcctgctggac
ccgggcgggctggcatggctgatcgatttcgaccggggcacggccggcggcgtgtccgag
cgggggcgccagggcaacctggcgcgcctgcgccgttccctcgtcaaggtcggcggcgag
cgggggcaggacttctggcagaggctggagccggcctaccgggccgcctgggcgcgcggg
accgcaagggcatga

DBGET integrated database retrieval system