KEGG   Bordetella pertussis 137: Q425_2600Help
Entry
Q425_2600         CDS       T03754                                 

Definition
(GenBank) lipase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00903  Limonene and pinene degradation
bpeu00930  Caprolactam degradation
bpeu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q425_2600
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Q425_2600
Enzymes [BR:bpeu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Q425_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S15 COesterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AJB25122
Position
complement(252709..253641)
Genome map
AA seq 310 aa AA seqDB search
MASAQLATLSAQVRQLYAGWDPNTDIARIRRDWDAFFGAVRLPARVTPVDAGGVPCHWIE
APASTRDRVVVFIHGGGYQIGSHRSHHNLMARLSAWSGRAVLSIGYRLAPQARCPAALED
VDAAHAWLAGQGWSARQTALCGDSAGGALAVLLLARLRARGAALPAACAVMSPWIDLQAR
GESYTANAASDPIANRATVLRMARAYLGRDGDPEAPAVSAQHADLRGLPPLLVQAGSAEA
LLDDARALAARAAASGVAVRLSVWQDMPHVFQLFAARLDAADAAIAELADFINHPLRAPT
GAEPRHETST
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atagcatcggcacagctggcgacgctctcggcccaggtccggcaactgtacgccggctgg
gacccgaacacggacatcgcgcggatacggcgcgactgggacgctttctttggcgccgtg
cgcctgcccgcgcgcgtcacgccggtcgatgccggcggcgtcccgtgccattggatcgaa
gccccggcatcgacccgcgatcgcgtggtcgtcttcatccatggcgggggctaccagatc
ggctcgcatcgctcgcaccacaacctgatggcgcggctgtccgcctggtccggccgggcg
gtgctgagcatcggataccgcctggcgccgcaggcgcgctgtccggccgcgctcgaggac
gtcgacgcggcccatgcctggctggccggccagggctggtctgcgcggcagaccgccttg
tgcggcgactccgccggcggcgcgctggccgtgctgctgcttgcgcggctgcgcgcgcgc
ggcgccgcattgcccgccgcatgcgccgtgatgtcgccctggatcgacctgcaggcccgg
ggcgagagctacaccgccaatgccgcgtccgaccccatcgccaaccgcgccaccgtgctg
cgcatggcgcgcgcctacctcggccgcgacggcgaccccgaagcgcccgccgtctcggcg
cagcacgccgatctgcgcgggttgccgccgctgctcgtgcaggccggctcggccgaggcg
ctgctcgacgacgcgcgggcgctggccgcgcgcgccgcagcaagcggcgtcgcggtgcgc
ctgagcgtgtggcaggacatgccgcatgtattccagcttttcgccgcacggctggatgcc
gccgatgccgccatcgcggaactcgcggatttcatcaatcacccattgcgcgcccccacc
ggcgccgagccccgtcatgaaacaagcacttga

DBGET integrated database retrieval system