KEGG   Bordetella pertussis 137: Q425_2950Help
Entry
Q425_2950         CDS       T03754                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00450  Selenocompound metabolism
bpeu00970  Aminoacyl-tRNA biosynthesis
bpeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Q425_2950 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q425_2950 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpeu01007]
    Q425_2950 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpeu03016]
    Q425_2950 (metG)
Enzymes [BR:bpeu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Q425_2950 (metG)
Amino acid related enzymes [BR:bpeu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Q425_2950 (metG)
Transfer RNA biogenesis [BR:bpeu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Q425_2950 (metG)
 Prokaryotic type
   Other AARSs
    Q425_2950 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e Anticodon_1 HalOD1
Motif
Other DBs
NCBI-ProteinID: AJB25151
Position
complement(286469..288547)
Genome map
AA seq 692 aa AA seqDB search
MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHFVGADDAHGAPIMLKA
EKEGITPQALVARYAAERPRYLDGFHIRFDHWHSTDTPENVALSQEIYRALKSEGLIETR
SIEQFYDPVKGMFLADRYIKGECPRCHAKDQYGDSCEVCGAVYAPTELINPYSALTGAAP
VLKSSDHFFFKLSDPRCVEFLQQWTTGANRQGVKHLQAEVQAKTREWLVGDDGEAKLGDW
DISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKSYCAAKGLDFDALLDPAGPTEQVH
FIGKDIIYFHALFWPAMLKFAGRKTPDQLNVHGFITVSGEKMSKSRGTGISPLRYLEIGM
DAEWLRYYMAAKLNARVEDMDFNPEDFVARVNSDLVGKYVNIASRAAAFITRHFDGELAY
DGDTDALAAEFAQQAESIRAAFEAREYNRAVREIMAHADRINQAFDAAQPWVMAKGIGAA
DAATRARLQDICSRALAGFKALSVMLAPVLPALASRVARELFGANADFAWGDAQQLPQRV
APFKHLMQRVDPKLLDDLFEPPAAEASAPAALPGGEALADTITIDDFAKIDLRIARIVNC
EEVEGSTKLLRLTLDVGEGRHRNVFSGIKSAYQPQDLVGKLTVLVANLAPRKMKFGVSEG
MVLAASHADEKAEPGIYVLEPWPGAQPGMRVR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcacgctcttcgtcaccactgccctgccctacgccaacggatcgttccacatc
ggccacatcatggagtacatccaggccgacatctgggtccgttcgatgcgcatggcgggc
cacacggtgcatttcgtgggtgccgacgacgcgcacggcgcgccgatcatgctcaaggcc
gaaaaggaaggcatcacgccgcaggcgctggtggcccgctacgccgccgagcggccgcgc
tacctggacggcttccatatccgcttcgaccactggcacagcaccgatacgcccgagaac
gtggcgctctcgcaggaaatctatcgcgcgctcaagagcgagggactgatcgagacacgc
tcgatcgagcagttctacgacccggtcaagggcatgttcctggccgaccgctacatcaag
ggcgaatgcccgcgctgccacgccaaggaccagtacggcgattcgtgtgaagtgtgcggc
gccgtgtatgcgcccaccgagctgatcaacccctattcggccctgaccggcgccgcgccg
gtactgaagtcgtccgatcacttcttcttcaagctgtccgatccgcgctgcgtcgagttc
ctgcagcaatggaccaccggcgccaaccgccagggcgtcaagcacctgcaggccgaagtg
caggccaagacgcgcgaatggctggtcggcgacgacggcgaggccaagctgggcgactgg
gatatctcgcgcgacgccccctatttcggcatcgagattcccgacgcgccgggcaagtat
ttctatgtctggctggacgcgccggtgggctacctggcctcgctgaaatcctattgcgcg
gccaagggcctggacttcgacgcgctgctcgacccggccggcccgaccgagcaggtgcac
ttcatcggcaaggacatcatttacttccacgcgctgttctggccggcgatgctgaagttc
gccgggcgcaagacgcccgaccagctgaatgtgcacggtttcatcaccgtcagcggcgag
aagatgtccaagagccgcggcaccggcatctcgccgctgcgctacctggaaatcggcatg
gacgccgaatggctgcgctactacatggcggccaagctgaacgcgcgcgtcgaggacatg
gacttcaaccccgaagacttcgtggcgcgtgtcaacagcgacctggtgggcaagtacgtc
aacatcgccagccgcgccgccgccttcattacccgccacttcgacggcgaactggcgtac
gacggcgacacggacgcgctggcggccgagttcgcgcagcaggccgaatcgatccgcgcc
gccttcgaggcgcgcgagtacaaccgcgcggtgcgcgaaatcatggcccatgccgaccgc
atcaaccaggcgttcgacgcggcgcagccctgggtgatggccaagggcatcggcgccgcc
gacgcggccacgcgcgcccgcctgcaggacatctgctcgcgcgcgctggccggcttcaag
gccctgtcggtgatgctggcgccggtgctgcccgcgctggccagccgcgtggcgcgcgag
ctgttcggcgcgaacgccgacttcgcctggggcgacgcgcaacagctgccgcagcgggtg
gcgccgttcaagcacctgatgcagcgcgtcgatcccaagctgctggacgacctgttcgag
ccgcccgccgccgaagccagcgcgccggccgccctgccgggcggcgaggccctggccgac
accatcaccatcgacgacttcgccaagatcgacctgcgcatcgcgcgcatcgtcaattgc
gaagaagtggaaggctcgaccaagctgctgcgcctgaccctggacgtgggcgagggacgc
catcgcaatgtgttctcgggcatcaagtcggcctaccagccgcaggacctggtcggcaag
ctgacggtgctggtggccaacctggcgccgcgcaagatgaaattcggcgtgtccgagggc
atggtgctggccgccagccacgccgacgagaaggccgaacccgggatctacgtgctcgaa
ccctggccgggcgcccagcccggcatgcgggtgcgctga

DBGET integrated database retrieval system