KEGG   Bordetella pertussis 137: Q425_38300Help
Entry
Q425_38300        CDS       T03754                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Q425_38300 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpeu03011]
    Q425_38300 (rplV)
Ribosome [BR:bpeu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Q425_38300 (rplV)
  Bacteria
    Q425_38300 (rplV)
  Archaea
    Q425_38300 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AJB28270
Position
complement(4028033..4028362)
Genome map
AA seq 109 aa AA seqDB search
METTAIIRGVHISAQKTRLVADLIRGKSVAQALNILTFSPKKAAVILKKAVESAIANAEH
NDGADIDELKVTTIFVDKAQSMKRFSARAKGRGNRIEKQTCHITVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactactgccattatccgtggtgttcacatctcggctcagaagacccgtctggtt
gcggacctgatccgcggcaagtcggtggctcaagccctgaacatcctcaccttctcgccc
aagaaggccgccgtcatcctgaagaaggctgtcgagtcggctatcgccaacgccgagcac
aacgacggcgccgatatcgacgagttgaaggtcaccaccatttttgtggacaaggctcaa
tcgatgaagcgtttctcggctcgcgccaagggccgcggtaaccgtatcgagaagcagacc
tgccatatcacggtcaaggtcggagcttaa

DBGET integrated database retrieval system