KEGG   Bordetella pertussis 137: Q425_38800Help
Entry
Q425_38800        CDS       T03754                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpeu  Bordetella pertussis 137
Pathway
bpeu00071  Fatty acid degradation
bpeu00072  Synthesis and degradation of ketone bodies
bpeu00280  Valine, leucine and isoleucine degradation
bpeu00310  Lysine degradation
bpeu00362  Benzoate degradation
bpeu00380  Tryptophan metabolism
bpeu00620  Pyruvate metabolism
bpeu00630  Glyoxylate and dicarboxylate metabolism
bpeu00640  Propanoate metabolism
bpeu00650  Butanoate metabolism
bpeu00900  Terpenoid backbone biosynthesis
bpeu01100  Metabolic pathways
bpeu01110  Biosynthesis of secondary metabolites
bpeu01120  Microbial metabolism in diverse environments
bpeu01130  Biosynthesis of antibiotics
bpeu01200  Carbon metabolism
bpeu01212  Fatty acid metabolism
bpeu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q425_38800
   00630 Glyoxylate and dicarboxylate metabolism
    Q425_38800
   00640 Propanoate metabolism
    Q425_38800
   00650 Butanoate metabolism
    Q425_38800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q425_38800
   00072 Synthesis and degradation of ketone bodies
    Q425_38800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q425_38800
   00310 Lysine degradation
    Q425_38800
   00380 Tryptophan metabolism
    Q425_38800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q425_38800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q425_38800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q425_38800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpeu04147]
    Q425_38800
Enzymes [BR:bpeu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q425_38800
Exosome [BR:bpeu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q425_38800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AJB28317
Position
complement(4086476..4087645)
Genome map
AA seq 389 aa AA seqDB search
MLSFPSPARPWAACWACLSGLAAHELGSAAIKAAIERAGIKPEQVDEVIMGNVLQAGQGQ
APARQAALGAGLPLGVGCTTIHKVCGSGLKAAMFGHDLLTADSVDVVVAGGQESMSNAPY
LLLKGRQGYRYGHNTVYDHMALDGLEDAYDRGKAMGVFAEDCATKYSFTREQQDAFSLES
LRRARAASEDGSFKWEITPVTVAGRKGDTVIDTDEAPTKAMPEKIPTLKPAFKKDGTVTA
ANSSSISDGAAAMVLMRASTAEKLGVKPLARIVAHAQHAQEPNWFTTAPVGALKNLFKKT
GWQASDVDLYEINEAFAVVTMATMKDFDLPHDKVNVHGGATALGHPIGASGARLMATLVG
ALRKTGGKRGVATLCIGGGEAVAMAIEML
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcgtttccgtcgcccgcacgcccatgggcggcatgctgggcatgcctgtccggc
ctggccgcccacgagctgggctcggccgccatcaaggcggccatcgagcgcgccggcatc
aagcccgaacaggtcgatgaagtcatcatgggcaacgtgctgcaggccggccagggccag
gcgcccgcccgccaggccgcgctcggcgccggcctgccgctgggcgtgggctgcaccacg
atccacaaggtgtgcggctcgggcctgaaggccgccatgttcggccacgacctgctgacc
gcggactcggtcgacgtcgtggtcgccggcggccaggaaagcatgagcaacgcgccctac
ctgctgctcaagggccgccagggctaccgctacggccacaacacggtgtacgaccacatg
gccctggacggcctggaagacgcctatgaccgcggcaaggcgatgggcgtattcgccgag
gactgcgccaccaagtacagcttcacgcgcgagcagcaggacgccttctcgctcgaatcg
ctgcgccgcgcgcgcgccgccagcgaagatggcagcttcaagtgggagatcacgccggta
accgtggccggccgcaagggcgatacggtgatcgataccgacgaggcgcctaccaaggcc
atgcccgagaagatcccgacgctcaagccggctttcaagaaggatggcaccgtcaccgcc
gccaactcgtcgtcgatctccgacggcgccgcggccatggtgctgatgcgcgcctccacc
gccgagaaactgggcgtcaagccgctggcccgcatcgtcgcccatgcccagcatgcgcag
gagccgaactggttcaccaccgccccggtcggcgcgctgaagaacctgttcaagaaaacc
ggctggcaagccagcgacgtggatctgtacgagatcaacgaagccttcgccgtggtcacc
atggcgaccatgaaggacttcgacctgccgcacgacaaggtcaacgtgcatggcggcgcg
accgcgctgggccaccccatcggcgcttcgggtgcgcgcctgatggccacgctggtcggc
gcgctgcgcaagaccggcggcaagcgcggcgtggccacgctgtgcatcggcggcggcgaa
gccgtcgcgatggccatcgaaatgctgtaa

DBGET integrated database retrieval system