KEGG   Bacillus pseudofirmus: BpOF4_07745Help
Entry
BpOF4_07745       CDS       T01165                                 

Gene name
mqoA
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00020  Citrate cycle (TCA cycle)
bpf00620  Pyruvate metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
Module
bpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BpOF4_07745 (mqoA)
   00620 Pyruvate metabolism
    BpOF4_07745 (mqoA)
Enzymes [BR:bpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BpOF4_07745 (mqoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like FAD_binding_3 TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ADC49607
UniProt: D3FQD5
Position
complement(3816090..3817589)
Genome map
AA seq 499 aa AA seqDB search
MSSIRRETDVILIGAGVMSATLGSMLKELAPELEIKVFEKLAKAGEESSNEWNNAGTGHA
ALCELNYTSEKPDGSIDVDKAIKINEQFHLSRQFWAYLVNQQLIRNPEEFIMPIPHISLV
QGENNVAFLRNRLEALSKHPLFKGMEFSEDPAKLKEWVPLIMEGRKENEPIAATKIDSGT
DVNFGALTRMLFDHLQKQNVETKYKHTVEDFKRMDDGRWEVKIQDDSTGNIEYHIAKFVF
IGAGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNPEVVERHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKSLLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGMKEMSLTKY
LIQQVMLSNEQRMDELREFMPNAKSEDWEVVVAGQRVQVIKDTEAGMGTLQFGTEVVSAS
DGSVAALLGASPGASTAVHVMIEVFQKCFPERMNEWEPKLKEMLPTYGVSPEVNPELFDQ
VHASTSQILGLGVEEPVFA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcattcggagagaaacagatgtgatcttaattggtgcaggagttatgagcgcg
actttgggttcaatgttaaaagagttagcgccggagttggaaatcaaagtatttgagaag
ctggcaaaggcaggagaagaaagctcgaatgaatggaataatgcagggacgggtcatgcg
gcgttatgtgaacttaactatacgtctgagaaacctgatggatccattgatgtagacaaa
gcaatcaaaattaatgaacagtttcacctttcaagacaattttgggcatatcttgtaaac
cagcagttaatccgtaacccagaagagtttattatgccaattcctcatatcagcttagtt
caaggggaaaataatgtagcgttccttagaaatcgtttggaagcgctatcaaaacacccg
ctgtttaaagggatggaattctcagaggatccagcgaaattgaaggaatgggttcctctc
attatggaagggcgcaaagagaatgagccgatcgcggcaacgaaaattgattctggaaca
gatgttaatttcggtgccttaacacggatgttatttgatcacttacaaaaacaaaatgta
gaaactaaatataaacatactgttgaagactttaagcgtatggatgacggtagatgggaa
gttaagattcaggatgattcgactggaaacattgagtatcacattgctaaatttgttttc
atcggtgccggcggaggcagtctccctcttcttcagaagacaggtattcctgaatccaag
catattggaggatttcctgtaagcggattatttatggtctgtaagaatccagaagttgta
gagaggcatcatgccaaagtatacggtaaggcaaaagtcggggctcctccgatgtctgtt
ccgcatctggatacgagatatattgataataaaaaatcgctgttgtttggaccgtttgcc
gggttctcgccgaaatttttgaaaacaggttcaaaccttgatttaattggttctgtcaaa
cctaataatgtattgacgatgcttgctgcagggatgaaagagatgtcattaacaaaatat
cttattcagcaagtgatgttatcaaatgaacagcgtatggatgaactgcgcgaatttatg
ccaaacgccaagagcgaagattgggaagtagtagttgcaggacagcgtgtgcaggtaatt
aaagatacagaggctggcatgggaacgctgcaatttggaacagaagtagtgagtgcatct
gatggctcagtggcagcattactaggagcttcaccaggcgcttctacagctgttcacgtc
atgattgaagtattccaaaaatgtttcccagagcgcatgaacgaatgggagccaaaactt
aaagagatgcttccaacgtacggagtgtcaccagaagtgaacccagagctttttgaccag
gttcatgcttctacttctcaaatccttggtttgggtgtagaagagccggtatttgcataa

DBGET integrated database retrieval system