KEGG   Bacillus pseudofirmus: BpOF4_11840Help
Entry
BpOF4_11840       CDS       T01165                                 

Gene name
recD_traA
Definition
(GenBank) ATP-dependent exoDNAse V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BpOF4_11840 (recD_traA)
Enzymes [BR:bpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BpOF4_11840 (recD_traA)
DNA repair and recombination proteins [BR:bpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BpOF4_11840 (recD_traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 UvrD-helicase UvrD_C AAA T2SSE AAA_12 AAA_22 Zeta_toxin AAA_16 AAA_17 TsaE DUF4926 AAA_28 AAA_29 HHH_3 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADC50421
UniProt: D3FVY9
Position
807290..809608
Genome map
AA seq 772 aa AA seqDB search
MDEQQSLEQDNGIERGYIKGEVLHLVFRNDENAYTVALIRVSETNEELKDKKITVVGILP
QLDVAETFLFFGTITDHPRFGQQYQVEQFRRDLPQTKNGIIQYLSSDRFPGIGKRTAETI
VEVLGERAITRIVEDRAVLKAVPKLSKEKADQLYQQLIDQQGVEQVLMTLSKHGFGLELS
MKVYQKYGFQALDIIQTNPYQLIADVEGIGFRKADLLGAAIGLTGNHPDRIRAGLLFVVQ
ELCLQDGHVYIEKEELIPHVKQLLSSPDASISTEEVEHELLTMEEEDALVLEETRVYIKS
LYFAEKGIVSSVRRLMATEVKDEFPESEFLKTLGELEEELKIEYAPQQKEAIQTALANPF
MLLTGGPGTGKTTVIKGIVETYARLNGLSLDPKAYTKSNPFPILLVAPTGRAAKRMSEAT
ELPAVTIHRLLGWKGGNGGFEKGEHEQLEGELIIVDEVSMVDIWLANQLLKAIPKGMQVV
FVGDQDQLPSVGPGQVLKDFLDAEVVPTVPLTAIYRQKEGSSIIELAHEMKQGKMPSDLP
EAKPDRRFFPCTTDHVQHVVTQICENAIKKGYLARDIQVLAPMYKGQAGITELNRILQEL
FNPKTEQKRELLYGELAYRTGDVVLQLVNNPDENVYNGDRGEIVAIFYAKENTEKQDQVV
ISFDGTEVVYNKKDLNQITHAYCCSIHKSQGSEFPIVVMPVVRNYSRMLRRNLIYTGITR
AKKFLLLCGELKSFHTAVTREDELIRYSMLKDKLVSLKQSQQEYENGNGQLT
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaacaatccttagaacaagataacggaatagagcgtggctatataaaaggc
gaggttctccatctcgtctttagaaatgatgaaaatgcctacactgtagctctgattcgg
gtcagtgaaacaaatgaagagctaaaggataagaaaataacggtagtgggaatccttccg
cagctggatgtagcagaaacctttttgttttttgggaccatcactgaccatccacgtttt
ggacagcagtatcaagtagagcaatttagacgagatctgcctcaaacaaagaacggcatc
attcaatatctttcaagtgatcgcttccctgggatcggcaagaggacagcagaaacgatt
gttgaggtattaggggaaagggccattactcggattgttgaagaccgagctgtactaaaa
gctgtaccaaagctctctaaagaaaaagcagaccaattatatcagcagctcatagaccaa
caaggagttgaacaggtcctaatgacgctgtcaaagcacggatttggtcttgaactatca
atgaaggtatatcaaaagtatgggtttcaagcacttgatattattcaaacaaatccttat
cagctgattgcagatgtagaagggatcggatttaggaaggctgatttacttggagctgcg
attggtttaacagggaatcacccagacaggatccgagcggggcttttgtttgttgtacaa
gaattatgcttacaagatggacatgtctatatcgaaaaagaagaattgatccctcatgta
aaacaactgttatcgtcaccagatgcatcaataagtacagaagaagtcgagcatgagctt
ttaacgatggaagaggaggatgcgcttgtacttgaggaaacgcgcgtctatataaaatca
ctgtattttgctgaaaaaggaattgtctcaagtgtaaggagactcatggctacagaggtt
aaggatgaattcccggaatcggagttcttaaaaacactaggcgagcttgaggaagagtta
aaaattgaatacgcaccgcagcagaaagaagcgattcaaacagcgttagctaatcctttt
atgctccttacaggggggccgggaacgggaaagacaaccgttattaaaggaattgtcgaa
acgtatgcaaggcttaacggtttatcacttgaccctaaagcgtacactaaatccaatcca
tttccaatcttacttgtcgcaccaactggaagagcggcaaagcggatgagcgaggcaaca
gaactgcctgctgttaccattcataggctgcttggctggaaaggcggaaatggtggattt
gaaaaaggagaacatgagcagctggaaggagaattgattattgtcgatgaggtttcaatg
gttgacatctggcttgctaatcaattgttaaaggcgatccctaaaggcatgcaggtcgtt
tttgtaggagatcaagatcaattgccttcagttggacctggccaagtacttaaagacttc
ttagatgcagaggtcgttccaacagttccgttaacagcgatctatagacaaaaggaaggc
tcctcgatcatcgaactcgcccacgagatgaaacaagggaaaatgcctagcgacctgcct
gaagcgaagcctgatcgacggttctttccgtgtacaaccgatcacgtccagcatgttgtg
acacagatttgtgaaaatgctataaaaaaagggtatcttgccagagacatacaagtgctg
gctccgatgtataaagggcaggctgggattacagaactcaatcgtattctccaggagctt
ttcaaccctaagacagagcaaaaacgagagcttttatacggggaacttgcttaccggaca
ggagatgttgtacttcagcttgtaaacaatcctgatgaaaatgtgtacaacggagaccgc
ggagaaattgtggcgattttctatgcaaaagaaaatacagaaaaacaagatcaggttgtg
attagttttgatggaacagaggttgtctacaataagaaagatttaaatcaaattacacat
gcttattgctgttcgatccataaatcgcaaggaagcgaatttccaatcgttgtcatgcct
gtagtacgtaattattctcggatgctgaggagaaatttaatttatacagggattactcgg
gcaaaaaaattcctgcttctatgcggcgaattaaaatcctttcataccgcagttacacga
gaagatgagttaatcaggtattcgatgttaaaagacaagcttgtctccctaaaacaatct
caacaggaatatgagaatggaaatggtcaactaacataa

DBGET integrated database retrieval system