KEGG   Bacillus pseudofirmus: BpOF4_18515Help
Entry
BpOF4_18515       CDS       T01165                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00071  Fatty acid degradation
bpf00072  Synthesis and degradation of ketone bodies
bpf00280  Valine, leucine and isoleucine degradation
bpf00310  Lysine degradation
bpf00362  Benzoate degradation
bpf00380  Tryptophan metabolism
bpf00620  Pyruvate metabolism
bpf00630  Glyoxylate and dicarboxylate metabolism
bpf00640  Propanoate metabolism
bpf00650  Butanoate metabolism
bpf00900  Terpenoid backbone biosynthesis
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
bpf01212  Fatty acid metabolism
bpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BpOF4_18515
   00630 Glyoxylate and dicarboxylate metabolism
    BpOF4_18515
   00640 Propanoate metabolism
    BpOF4_18515
   00650 Butanoate metabolism
    BpOF4_18515
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BpOF4_18515
   00072 Synthesis and degradation of ketone bodies
    BpOF4_18515
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BpOF4_18515
   00310 Lysine degradation
    BpOF4_18515
   00380 Tryptophan metabolism
    BpOF4_18515
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BpOF4_18515
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BpOF4_18515
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BpOF4_18515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpf04147]
    BpOF4_18515
Enzymes [BR:bpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BpOF4_18515
Exosome [BR:bpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BpOF4_18515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADC51744
UniProt: D3FSA9
Position
complement(2051879..2053033)
Genome map
AA seq 384 aa AA seqDB search
MREVVIVEAVRTPLGKRKGALSNLRADELLALPLKELVERTNIDPADIEDVIAGCVSQVG
EQAPDIARLAALIAGYPIEVPGVTIDRQCGSSQQAVHFAAQAIASGDMDVVVAAGVEHMT
RVPMFSNVQGSSYSKKLSDKYELLHQGVSCERMAEKWELTKEELDQFSLNSHKKAVSAWE
AGHFDREVMPIHCTAEDGSVIELTKDEGPRADTTLEALQSLKTVFKEEGGTITAGNASQM
SDGAAAILLMSRDKADALGLKPRCKITARSVVGSDPTLMLTGPIPATHKVLKKAGLTIED
MDLYEVNEAFAPVPLIWAKEVGADLNKLNPNGGAIALGHPLGASGARVMTTLLHELERTG
GRYGLQAICEGFGMANATIIERLD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagtcattgtagaagcagtaagaactccgctaggaaagagaaaaggtgcc
ttatcaaacctccgtgcagatgaactattggcgctgcctttaaaagagcttgttgagcgg
acgaacattgatcccgcagatattgaagatgtaattgccggctgtgtctcgcaagtagga
gagcaggcaccagatattgcacggctcgcagcgcttattgcaggctatcccattgaagta
cctggtgtgacgatcgaccgtcaatgcggctcaagccagcaagccgttcattttgctgcg
caagcgattgctagcggtgatatggatgtcgtcgttgcagccggagttgagcatatgacg
cgggttccaatgttttcaaatgttcaaggaagctcttacagtaaaaagctaagcgacaaa
tatgaactcctgcatcaaggggtatcatgtgaacggatggccgaaaaatgggaattaaca
aaagaagaattggatcagttctcgttaaacagtcataaaaaagcagtaagtgcttgggaa
gctggacatttcgaccgtgaagtgatgccgattcattgtacggcagaagacggatcagtt
attgagctgacaaaagatgaaggtccaagagcagatacaacattagaagctttgcaatct
ttaaaaacagtgttcaaagaagagggtggcaccattacggcgggaaatgcaagtcaaatg
agcgacggggcggcagcaattctacttatgtcacgtgataaagcagacgctttaggtctt
aaaccccgctgtaaaattacagcacggagcgtagtcggctctgatccaacacttatgctg
accggaccaatcccagctacgcataaagtattaaagaaagccggcttaacgattgaggac
atggacctttatgaagtaaatgaagcgttcgctcccgttccgcttatttgggcgaaggaa
gtaggggcggacttaaataaactaaaccctaacggtggtgcgatagctcttggccacccg
cttggagcaagcggggcacgtgtgatgacgactttgctccatgagcttgaacgtacagga
ggacgctacggccttcaagctatatgtgaaggttttggcatggcgaatgcgacgattatt
gaacgactagactga

DBGET integrated database retrieval system