KEGG   Bathycoccus prasinos: Bathy01g00820Help
Entry
Bathy01g00820     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
bpg  Bathycoccus prasinos
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpg04147]
    Bathy01g00820
Enzymes [BR:bpg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     Bathy01g00820
Exosome [BR:bpg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bathy01g00820
  Exosomal proteins of other body fluids (saliva and urine)
   Bathy01g00820
  Exosomal proteins of colorectal cancer cells
   Bathy01g00820
  Exosomal proteins of bladder cancer cells
   Bathy01g00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 19017818
NCBI-ProteinID: XP_007515643
UniProt: K8E9S2
Position
1:complement(join(153654..157010,157260..157292))
Genome map
AA seq 1129 aa AA seqDB search
MARSKKDTSAEDERKANLRKDIDFVEHTWPAEKLYSHFGCTLEKGLSSEQVLINRGKYGE
NRLTPPALTPWYIQFLLQFANFFAALLLAGGTLCFIGYGIDTEKDQTNLFLGIVLYAVVT
ITATFSYLQEAKSEKIMEGFKNMIPKKCKCIRDGKNTVVDAWELVPGDVVDLLDGDQVPA
DIRVMSANELKVDNSSLTGESEPQDRSTDLAKDSQGNLVMQPLEASNLCFYTTIINSGSG
RGIVIGSGDRTVMGQIAGLATETSNEASPINVEISKFIQLISAVAITLGVVFFIIGLTNG
TDIIQNVVFMIGIIVANVPEGLLATVTVSLALTAKRMHTKNVLVKNLEAVETLGSTTIIA
SDKTGTLTQNRMTVMHVWVDNETYLCPAGKNIPDLAVLSQTPADEPYYDASSPGFKRLLQ
VATLCNNAEFLTKNDDGSYMDLKAEMNNPNFNILKQAATGDASEQGLLKLVQPLNDALET
RAACPKIFEIKFNSTNKWQLSIHSQGAGRPPLLVLKGAPERVLGMCKSYFAKGEVKEINA
SYNKTYTEAYEGLGGRGERVLGFAYKELTGMKDDFKFSNKPAPNFTMNDLTFVGLISLID
PPREGVPEAVIKCNRARVKVYMVTGDHPITAAAIAKQVNIISQENIDSGDAIVVKGDTIR
EWTEIADPVEQQKKWDAALDHKQIVWARVSPAHKLLIVENCQRRGEIVAVTGDGVNDAPA
LKKGDIGVAMGIAGKDVSKEAADMILMDDNFASIVNGVEEGRLIFDNLKKSIAYTLSSNI
PEIAPFLIYITAKLPLPLSTVLILCIDLGTDMVPAISLAYETKEADIMDRPPRNAQTDRL
VNFRLISFAYLQIGMIQALAGFFVYIIVLNDYGYAPNILMGNGLEWFKHSVMCTINGDGS
PKECGFGCEGEDWERGYCEGGCQVPVTSEVDPFIEFTSAGFRGDGEYTCNRACSNYASIP
SDKLTDAEKARFDTLCAIDSTWGFADRGFADKEAIAPAGAMYFWNGQPQPLPNKNYQSSA
LEYAQCAYFISIIIVQWADLLICKTRKLSLFQQGLQNDFMNFGLLFETVLGATLVYTPAL
NTVFGTRPLHILHWFPAVPWSMFIFTYDEMRKAIMRQNPDGWLNSYTYW
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttcgaagaaagatacttcagccgaggatgagcgcaaagcgaatttgcgtaaa
gatatcgattttgtcgagcacacgtggccggcagaaaagctctactcgcactttgggtgc
accctggagaaaggtttatcgagcgaacaggttttaatcaaccgcggtaaatatggcgag
aaccgattgactccgccggcgttgacgccgtggtacattcagtttttgctgcagttcgcc
aactttttcgccgctttgttgttagccggtggcaccttgtgtttcatcggctatggcatc
gatacggagaaggatcaaaccaacttgtttttgggcatcgtcttgtacgccgtcgtaact
attacggcgactttctcgtacttgcaagaggccaagtcggagaagatcatggaagggttc
aagaacatgattccaaagaagtgcaagtgcattcgcgacggtaagaacaccgtcgttgat
gcgtgggagttggttccgggagacgtcgtcgatttgctcgacggcgaccaggtgccggcg
gatattcgcgtcatgtcggcaaacgaattgaaggtggacaattcttctttgactggtgaa
tccgaaccacaagatcgctcgacggatttggccaaggactcgcaaggtaacttggtcatg
caaccgttggaagcgagcaacttgtgcttttataccacgattatcaactccggttccggg
agaggcatcgttattggatccggtgaccgcacggtcatgggtcaaatcgctggtttggcc
acggaaacgtccaacgaagcgtcgccgattaacgttgaaatctccaagttcattcagttg
atttccgccgtcgccattaccttgggcgtcgtgtttttcatcatcggtttaaccaacggg
acggacattatccaaaatgttgtgtttatgattggtatcatcgttgcgaacgtgccggaa
ggtttgttggcgaccgttaccgtgtctctcgcgttgaccgcgaaacgtatgcacacgaag
aacgttttggtgaagaacttggaagcggttgaaactttgggttcgaccactatcatcgcc
tcggataagactggtactttgacgcaaaacagaatgactgttatgcacgtatgggtcgat
aacgaaacgtatttgtgtccagccgggaagaacattccggatttggcggttttgtcgcaa
actcctgcggatgaaccgtactacgacgcaagctccccgggcttcaaacgattgttgcaa
gtcgcgacgttgtgtaacaacgccgagtttttgactaaaaacgacgacggctcgtacatg
gacttgaaggcggaaatgaacaacccgaacttcaacatcttgaagcaagccgcaactggt
gacgcttccgagcaaggcttgttgaagctcgtgcaaccgttgaatgatgcgttggaaacc
agagccgcgtgcccaaagattttcgaaatcaagttcaactccacgaacaagtggcaattg
tccattcactctcaaggtgccggcagaccgccgttactcgtcttgaagggtgctccggag
agagtgctcggcatgtgcaaatcgtactttgccaagggcgaagtgaaggaaatcaacgcg
tcgtacaacaagacgtacacggaagcgtacgaaggtttgggcggccgcggtgaacgcgtg
ttgggatttgcctacaaagagttgaccggaatgaaggacgattttaagttttccaacaag
ccggctccgaactttaccatgaacgatttgacttttgttggtttaatctcattgattgat
cctccgagagaaggcgtccctgaagccgtcatcaagtgcaaccgcgctcgcgtgaaggtg
tacatggtgaccggcgatcacccgattaccgcagcggctattgcgaagcaagtcaacatt
atttcgcaagagaacatcgacagtggcgatgccatcgtcgttaagggcgatactattcgt
gagtggacggaaatcgccgaccccgttgaacaacaaaagaagtgggacgcagcgctcgat
cacaaacaaatcgtctgggcgagagtgtctccggcgcacaagttgttgatcgttgagaac
tgtcagcgcagaggtgaaatcgttgccgtcactggtgatggtgtgaatgatgcgccggcg
ttgaagaagggtgatattggtgttgccatgggtatcgccggtaaagacgtttccaaggaa
gcggctgatatgattttgatggacgataactttgcgtccatcgtcaacggcgtcgaagaa
gggcgattgatctttgataacttgaagaagtccatcgcgtacactttgtcgtcgaacatt
ccggaaattgcgccgtttttgatttacatcacggcgaaattgccgttgccgttgtcaacg
gttttgattctctgtatcgatcttggtacggatatggtccctgccatctctctcgcttac
gagaccaaggaggcagatatcatggaccgcccgccgagaaatgcgcaaactgatcgtttg
gtcaacttccgtttgatttcgttcgcgtacttgcaaatcggtatgatccaagccttagcc
ggcttcttcgtctacatcatcgtcctcaacgattacggctatgcgccgaacatcttgatg
ggcaacggtttggaatggttcaagcactccgtcatgtgtaccatcaacggcgacgggagt
ccgaaagagtgcggtttcggttgcgaaggtgaggattgggagagaggttactgcgaaggc
ggttgccaagttcccgtcaccagtgaggtcgatccgttcatcgagttcacctctgctggt
ttcagaggtgacggtgaatacacttgcaacagagcgtgctcgaactacgccagtattcct
tcggataaacttactgacgcggaaaaggcgcggtttgatacgctttgcgcgattgacagc
acgtggggctttgccgatcgtggtttcgcggataaggaggctatcgctccggcgggtgcc
atgtatttctggaacggccagccacaacccttaccgaacaagaactaccaaagttctgct
ttggaatacgcgcaatgcgcgtacttcatctccatcatcatcgtccaatgggccgatttg
ttgatttgcaagacgagaaagctttctctcttccagcaaggcttacaaaacgatttcatg
aactttggtttgttgtttgaaaccgtcctcggggcgactttggtatacactccagccttg
aacactgtctttggtactcgaccgttgcacatcttgcactggtttccggccgttccgtgg
tctatgttcatcttcacctacgatgagatgagaaaggcgatcatgagacaaaatccggac
ggctggttgaattcgtacacgtactggtaa

DBGET integrated database retrieval system