KEGG   Bathycoccus prasinos: Bathy06g02350Help
Entry
Bathy06g02350     CDS       T03089                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00010  Glycolysis / Gluconeogenesis
bpg00030  Pentose phosphate pathway
bpg00051  Fructose and mannose metabolism
bpg00710  Carbon fixation in photosynthetic organisms
bpg01100  Metabolic pathways
bpg01110  Biosynthesis of secondary metabolites
bpg01200  Carbon metabolism
bpg01230  Biosynthesis of amino acids
Module
bpg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bpg_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bpg_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bathy06g02350
   00030 Pentose phosphate pathway
    Bathy06g02350
   00051 Fructose and mannose metabolism
    Bathy06g02350
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bathy06g02350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpg04131]
    Bathy06g02350
   03036 Chromosome and associated proteins [BR:bpg03036]
    Bathy06g02350
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpg04147]
    Bathy06g02350
Enzymes [BR:bpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Bathy06g02350
Membrane trafficking [BR:bpg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bathy06g02350
Chromosome and associated proteins [BR:bpg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    Bathy06g02350
Exosome [BR:bpg04147]
 Exosomal proteins
  Proteins found in most exosomes
   Bathy06g02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 19015215
NCBI-ProteinID: XP_007512433
UniProt: K8F653
Position
6:complement(424360..425397)
Genome map
AA seq 345 aa AA seqDB search
MMTGFDDALRATCAKLAEPGKGILAADESTGTIGKRFQSIGVENVEANRRFWRETLFTAK
EVEKYISGVILFEETLYAKSEDGTETLTEILRKKDIVPGIKVDKGATIPVGKDGDGETDT
DGMDGLGERCAAFYKAGARFAKWRAVLKIDVEKALPSADAVEANAKSLAKYAKICQENGL
VPIVEPEIVPDGKHDVEVSKTVTKNVLTKVFEHLNKENVNLELMVLKPNMVTPGSGNEES
EKDDLKVAEYTNEVLLACVPEAVPAILFLSGGQSEDAASRRLNLMHKMQKESDKTFPWTL
SYSYGRALQASALKAWSGDNSNAGKAQEAFIEKAKSCSLASLGEL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagggtttgatgatgcgttgagagcgacgtgcgcgaaactcgccgaaccaggg
aaaggcatcctcgcggcggacgaatccaccgggacgattggaaaacgatttcaatcgatc
ggggtggaaaacgtggaagcgaaccgtcggttttggcgagagaccttgtttaccgcgaag
gaggtggaaaagtacatctccggggttattttgttcgaggagacgttatatgcgaaaagc
gaagacgggacggaaacgctgacggagatcttaaggaagaaagatattgtccctgggatt
aaagtggataaaggggcgacgataccggtcgggaaagacggagacggagagacggatacg
gatgggatggacgggttaggcgaacggtgcgcggcgttctataaagccggggcgagattt
gcaaagtggcgggcggtgttgaagattgacgtcgagaaggcgttgccgagcgcggacgcg
gtggaggcgaacgcgaagagtttggcgaagtacgccaagatttgtcaagagaacgggtta
gtaccgatcgtggagccggaaattgtgccggatggtaagcacgacgtggaggtgtcgaag
acggtgacgaagaacgtgttgacaaaagtcttcgagcatttgaacaaagagaacgtgaat
ttggagttgatggttttgaaaccgaacatggtgacgccgggaagcgggaacgaagagtcg
gaaaaagacgacttaaaagtggcagagtataccaacgaggtgttgttagcgtgcgtgcca
gaggcagtgccggcgattttattcttgtccggcggccaatccgaagacgcggccagtcga
aggttgaatttaatgcacaagatgcaaaaggagtccgacaaaacgttcccgtggacgctt
tcgtatagttacgggagagcgttgcaagcgtccgcgttaaaagcttggtctggagataac
agcaacgccggtaaagcgcaagaggcgttcatagaaaaagcgaaatcgtgttcgttagcc
agtttaggagaactttaa

DBGET integrated database retrieval system