KEGG   Bathycoccus prasinos: Bathy06g02490Help
Entry
Bathy06g02490     CDS       T03089                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
bpg  Bathycoccus prasinos
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bathy06g02490
Enzymes [BR:bpg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     Bathy06g02490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx SARAF
Motif
Other DBs
NCBI-GeneID: 19015229
NCBI-ProteinID: XP_007512716
UniProt: K8EH03
Position
6:complement(join(447176..447546,447580..448078))
Genome map
AA seq 289 aa AA seqDB search
MGSENGSKATTATSKSSLSRMGAMIILSLFAFVLFSMTTTLGNSSSNSSLGGGEGGLGGG
RRRVHTKMANLASESPEMLGLTVQKREKKRETTSEDDEKRRRRGGQAKLGANADHVSEKE
EEREIIMLPHVRTNIYDPLPNQFQLNGEPFDFTSLRGKVSLFANVASFAGLRERFASKDV
QIVSYPCNQFGHQEPGTPEEILKFAKEHAYPEDAILMQKVDVNGKNADENWKLLKAAFKN
KDVFWNFEKFLVDRNGVPKKRYGSTWSKDIAKDIETLLSEEEEQAGEDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggagaacggttcaaaagcgacgacggcgacgagtaaatcgtcgttgagtcgc
atgggcgcgatgattattctttcccttttcgcgttcgttctcttttcgatgacgacgact
ttggggaactcgtcgtcgaactcgtcgttaggaggaggagaaggaggattaggaggaggt
agacgacgcgtgcacacgaagatggcgaacttagcgagcgagtcgccggagatgttagga
ttgacggtgcagaagagggagaagaagagggaaacgacgagcgaggacgacgaaaagagg
aggaggcgaggaggacaggcaaagttaggggccaacgcagaccatgtgtcagaaaaagaa
gaagaacgagaaataataatgctaccgcacgtgcgaacgaatatctacgatccactaccg
aaccaattccaactgaacggcgagccgttcgatttcacctcgctgcgaggtaaagtctcg
ctcttcgcgaacgtggcgagctttgccggtttgcgcgaacgcttcgcatcgaaagacgtg
caaatagtctcgtatccgtgtaatcagtttgggcatcaagaaccgggcacgccggaggag
atattaaagtttgccaaagaacacgcgtacccggaggatgctattttaatgcaaaaagta
gacgtaaacgggaagaacgcggatgaaaattggaagctactcaaagccgcgtttaaaaac
aaagacgtcttttggaactttgaaaagtttctggtcgatcgaaacggtgttcctaaaaag
agatacggcagcacgtggtcgaaagacatcgccaaagatatcgaaactctcttgagcgaa
gaagaagagcaagccggcgaagacttgtaa

DBGET integrated database retrieval system