KEGG   Bathycoccus prasinos: Bathy06g04880Help
Entry
Bathy06g04880     CDS       T03089                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00450  Selenocompound metabolism
bpg00970  Aminoacyl-tRNA biosynthesis
bpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Bathy06g04880
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bathy06g04880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpg01007]
    Bathy06g04880
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpg03016]
    Bathy06g04880
Enzymes [BR:bpg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Bathy06g04880
Amino acid related enzymes [BR:bpg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Bathy06g04880
Transfer RNA biogenesis [BR:bpg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Bathy06g04880
 Prokaryotic type
   Other AARSs
    Bathy06g04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 19015469
NCBI-ProteinID: XP_007512456
UniProt: K8EGB2
Position
6:complement(926900..929776)
Genome map
AA seq 958 aa AA seqDB search
MSNNNSTSLKLIYRAGDSKPLRVYIAAEVDGNKTAIEFDPWKAASCSDHSSSSSSSNKNN
KNKNTGAVLQKTTSASATLFIALCSSSGEVVKGTSMNSALLCVRDGDDASFINFRDLDER
ELGLTVGTCCAEKSLNTLIQYISKNEKKLKDTVPGIFSSPASTQPTNSEIAFFSSVYPVF
ANGAEMFGKTSSDASLTKQFKSIETWFNAFLKSSSVQNAMEKAKTTPSSAFLFAAQEAQN
VSDLKNAYNPPVDPSKDAFSLTTAINYANGAPHMGHAYEGLSADVIARYHRAYGRPTLFQ
TGADEHGQKISDAAAAVECKPIELCDKHVKMFQDLNKTLRIENDVYNRTTSEKHKQCCRE
LFERSEKNGDIYLDTYSGWYNVREETFVTETEAKEMDYKDPVSGKPLKQMEEDSFFFRQS
KYQARLIEHIENHPEFIQPEGRKGEILYRLKNDELRDLSVSRTTFDWGIPVPGNSKHVLY
VWFDALTNYLTGCDFPNGENYSKFWPANVHIIGKDIIWFHCVIWPCMLMSCNIALPKAVF
AHGFVTAADGQKMSKSIGNVVDPLDVLKRCSPDTFRYALMRNGIYGSDIPFSEESMTLIH
NADLADTLGNLVHRATHLCSKNCEGRVPDVPIFEKVIDVGLLRLKTERAMESFQLQQACE
LAINSAKAANKYITDAEPWKLKGEETKHRRDVIIRTTLEAVYITALFLQPYIPTACEDIF
KKLGMDASKVHKLWELKPFGENVKPGTQVAVGEVLFQKHEIDTAELFKKAQSSKEEKAAK
LAKKKKGEENTKIDVTRLDLVVGEITKVWNHPDADTLYVENININGDKPLQVCSGLVKHI
PIDKMLNARVVLVANMKPTKMRGVESEAMVLCATDPNDSNKVEIVTPPKGAAIGERVTFD
GYENDPDEKLNPKKKVFEAVQPDFLVNKDGIATYKNVPFQTTAGPCSVESIREGGSIR
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaataacagcacttcgttaaagttaatctaccgagccggggactcgaaacct
ctgcgcgtgtacatcgccgcggaagtcgatggaaacaaaacagcaatcgagttcgacccg
tggaaagccgccagttgttcggaccactcttcttcttcttcttcttcgaataaaaacaac
aagaacaagaatacgggagcggtgttgcaaaagaccaccagcgcatccgcgacgttattt
atcgctctctgttcttcatccggagaggttgtaaaaggcacgtccatgaacagcgcgttg
ctgtgtgttcgagacggtgatgatgcttctttcatcaactttagagacttggacgaacgc
gagctcggtttgactgtgggtacgtgctgcgcggaaaagagtttaaatacactgatacag
tacatatcaaagaacgagaaaaaattgaaagataccgtcccgggtattttctcttcgccc
gcgtcgactcaaccgaccaatagtgaaatagcgttcttctcgagcgtgtatccagtcttc
gcaaacggcgcggagatgtttggaaagacttcttcggacgcgtccttaacgaaacagttt
aaaagcatcgagacttggttcaacgcctttttgaaaagctcttctgtgcaaaacgcgatg
gaaaaagcgaagacgactccatcgtccgcgtttctgttcgccgcgcaagaggcgcaaaac
gtctcagatttgaaaaacgcgtataatcctcccgtggatccatcaaaagatgcgttttcg
ctcacgacggcaatcaattacgcgaatggcgccccgcacatgggacacgcgtatgaaggt
ttaagtgcggatgtcatcgcgagataccaccgcgcgtacggtcgaccgacgttgttccaa
actggtgcggatgagcacgggcaaaagatttccgacgccgcggctgccgttgagtgcaaa
ccgattgaattgtgcgataaacacgtgaaaatgtttcaagatttaaacaaaacgttacga
attgaaaacgatgtctacaacagaacaacctcagagaagcacaaacagtgctgtcgagaa
ctctttgagagaagcgaaaagaatggcgatatttatttagacacgtactcggggtggtac
aacgttcgcgaagaaacgttcgtgactgaaaccgaagcgaaagaaatggattacaaagac
ccagtttcgggcaaacctttgaagcaaatggaagaggactcgttcttttttcgccaatcg
aaatatcaagcgcgattgattgaacacattgaaaaccacccagagtttattcagcctgaa
ggacgcaaaggagaaattttataccgattgaaaaacgacgagttgagagatctgagcgtc
tcgcgaacgacgttcgattgggggattcccgtgcctggaaatagcaaacacgtcttgtac
gtttggttcgatgctttgacaaactatttgaccggttgtgattttccgaacggagaaaac
tactcgaagttttggccggcgaatgtacacatcatcgggaaagatatcatctggttccac
tgcgtcatttggccgtgcatgttgatgagttgcaacatcgccttgccgaaagctgtgttc
gcgcacggctttgtcaccgcagcggatggacagaaaatgtccaaatctatcgggaacgtc
gttgatccgttggatgttttgaaaaggtgttctccggatacgtttcgatacgcactcatg
cgaaacggcatttacgggtccgatattccatttagcgaagaatctatgaccttgattcac
aacgcggatttagcggatacgctcggaaatttagttcacagagcgacgcatttgtgctcg
aagaattgcgaaggtcgtgtcccagatgttccaatctttgaaaaagtaatcgacgtcggc
ctgttgagattgaaaacggagcgcgcgatggaatcgttccagttacaacaagcctgcgaa
ttagccatcaactcggcgaaagctgcaaataaatacatcaccgatgcagaaccgtggaaa
ttaaaaggcgaggaaacgaaacatcgcagagacgtgatcattcgcacgactttagaggct
gtgtacatcacagcgttgtttttacaaccgtacataccgaccgcgtgtgaagacatattt
aagaaactcgggatggacgcctcgaaggtccacaaactctgggagctcaaaccattcggc
gagaatgtgaaacctgggacccaagtcgccgtcggcgaagtgctctttcaaaaacacgag
attgacaccgcagaactcttcaagaaggcacaatcgagcaaggaagaaaaagccgccaaa
ttggcgaagaagaagaaaggcgaggagaatacgaaaattgacgtcacgcgattagattta
gtcgttggtgaaatcacgaaagtttggaatcaccctgacgcggatacgctttacgtggaa
aacatcaacatcaacggcgacaaacccttgcaagtctgttcgggattggtaaaacacatt
ccgattgataaaatgctcaacgctcgtgtcgttctcgtcgcgaacatgaaaccaacgaaa
atgcgcggtgtagagtcggaagccatggttttatgcgccaccgatccgaacgatagcaac
aaagttgaaattgtcaccccgccgaaaggcgctgccatcggtgaacgcgttactttcgac
ggctacgaaaacgacccagacgagaagttaaacccgaagaagaaggtgttcgaagctgtg
caaccggattttctggtgaataaagatggaattgccacgtataagaacgttccgttccaa
acgaccgctggtccgtgttcggtagagtccatcagagaaggcggctcgattaggtga

DBGET integrated database retrieval system