KEGG   Bathycoccus prasinos: Bathy07g03290Help
Entry
Bathy07g03290     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
bpg  Bathycoccus prasinos
Pathway
bpg04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    Bathy07g03290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bpg04131]
    Bathy07g03290
   03029 Mitochondrial biogenesis [BR:bpg03029]
    Bathy07g03290
Membrane trafficking [BR:bpg04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Bathy07g03290
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    Bathy07g03290
Mitochondrial biogenesis [BR:bpg03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Bathy07g03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG16 WD40 Mto2_bdg Cnl2_NKP2 DUF2353 CENP-F_leu_zip
Motif
Other DBs
NCBI-GeneID: 19014818
NCBI-ProteinID: XP_007511950
UniProt: K8F157
Position
7:complement(642245..643915)
Genome map
AA seq 556 aa AA seqDB search
MEEDLFLKREVLEKLRRRNEEEVLPFVEIFASHRKARKRCEKLQHEVQQLRNKTAELSGK
NVGLMSALTRAQEENAKAKTSKENSAKVSRLQEELTEAHKKNVEVMEMASTANREKEKAK
TELETTSNELKNAKAALKNLRDSCANLENELKTAQKAAEIAGAEVEARQEDKLTAIARVE
ELKKENQQLVERVMEMKMKEAEKMNEINELYEDLQRQKKASELKSIANEMNATASASMRG
LSLDSSSSPGFGDSFAGSIPSREQFHCQANQGATHRVSFFRSGEILGTCGDDKRVALVNA
NSGQVSSYLEGALGSLLDLSFSPDDNFCLGCGTDKAIQLWELSSGRVRHRMTGHADKVVG
VEFCRMDKQRAISCSHDRTIREWDLHKGICLTSTPCASNVNTVVYGDTSQFVLSGHLDGG
VRIWDLRSRGGLPTNEKKAVHEQQVTSIQLLPNEREILTCGRDNVIRILDCRTLEVSAEF
SASNFRVGTNWTNPSFSPNQSHIACGGADGAVFIWSATDRVLRTTLRKHNAVVATTAWSP
SGLASCDKNGKCILWS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagatttatttctaaagcgagaagttttagaaaagttacggcgaagaaacgaa
gaagaagtccttccgttcgtagagatcttcgcgtctcacaggaaagcgcgcaaacgatgc
gaaaagttacagcacgaggttcaacagttgagaaataaaaccgcagagttgagcgggaaa
aatgttggactgatgagtgctttaacgagagcgcaagaagaaaacgcgaaagcgaaaacg
agcaaagaaaattccgcgaaagtctcgagattgcaggaagaattgaccgaggcgcacaag
aaaaatgtggaagttatggaaatggcatcgactgcgaatcgcgaaaaagagaaagcaaag
actgagttggaaacaacgtcgaacgagttaaaaaacgcgaaagcggctttgaaaaattta
cgcgattcgtgcgcaaacttggagaatgaattgaaaacggcgcagaaagcggcggagatc
gccggagcagaagtggaagcgaggcaggaagataaactgacggcaatcgcgcgcgtagaa
gaattgaaaaaggaaaatcaacaactcgtagaaagagtgatggagatgaaaatgaaagaa
gcggagaagatgaacgaaatcaatgagttatacgaagacttgcagagacaaaagaaggca
agcgaattgaaatcgattgcgaacgaaatgaacgcgacggcatccgcaagtatgcgtggt
ctatcgttggattcgtcctcgtctcctggttttggagattcgttcgcgggaagtattccg
agtcgagaacagtttcactgtcaggcgaatcaaggcgcgactcatcgagtgtctttcttc
agatcgggtgaaatattaggaacgtgtggagacgacaagcgcgtcgcattggtgaatgca
aattcagggcaagtttcttcgtatttagagggtgctttaggaagtcttttggatctctca
ttctccccggatgataacttctgtttgggatgcggcactgataaagctattcagctctgg
gaactatcgagtggacgcgtgcgacatcgaatgactggacacgcggataaagtcgtcggt
gtggaattttgtcgcatggataagcaaagagcgatttcgtgctcgcacgatcgaaccatt
cgagagtgggatttacacaaaggcatatgtttgacttctacgccgtgcgcttcaaacgtg
aacacggtcgtgtatggggacacttcccaattcgtcttgagtggtcatttagacggtggt
gtgaggatttgggatctgcgatcgcgcggtggactacctacaaatgagaagaaagctgtt
cacgagcagcaagtaacctcgatacagctgttaccaaacgaacgcgaaattttgacatgc
gggcgcgacaacgtgattcgaatattagattgcagaaccctagaggtttccgcggaattc
tctgcttcgaatttccgcgttggaacgaattggacgaacccgtctttttcgccgaatcaa
tcgcatatcgcttgcggcggcgcagatggagccgtttttatctggtcagcgaccgatcgc
gtgctgagaacgacgttgcggaagcacaacgctgtcgtcgcgacgaccgcatggagccca
tctggattagcgagttgcgataaaaacgggaaatgtatcttatggagttga

DBGET integrated database retrieval system