KEGG   Bathycoccus prasinos: Bathy08g01080Help
Entry
Bathy08g01080     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
bpg  Bathycoccus prasinos
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpg01001]
    Bathy08g01080
Enzymes [BR:bpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     Bathy08g01080
Protein kinases [BR:bpg01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   Bathy08g01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Menin YrbL-PhoP_reg Dishevelled SelP_N
Motif
Other DBs
NCBI-GeneID: 19014087
NCBI-ProteinID: XP_007511388
UniProt: K8EHN2
Position
8:join(187040..187229,187426..188489)
Genome map
AA seq 417 aa AA seqDB search
MSTENRGGEAHTHNINNNTNNNNNAFGGGGGGQGGNFPRAIVPIQDVSEILSKYDFKEKI
GTGGFATVMRAIEKDTGVEVAIKIVDRQKYAPTDKSYEREFQVLSTLYHENIINLRCTYV
TEKNVFMVTEVVHGGELLERITEEGSYSEADARRIIVQILKAVEYLHSKKVVHRDIKLEN
ILMSDRSPKATVKLIDFGLSRLPQVGSEMRTICGSPLYVAPEILDMNLSDTAYTPAVDMW
SVGVILFILLSGYSPFDHDDEEQLFKNIKEGVYCMDDRIWRYISEGAKDCVRQLLTVDVM
NRMTATQALQHPWIRQKHHHHHHHHHNNNNNNDNNNNNDISSIMTSETNSTGFTDGGGSL
TSSMNMQPPEQMPKEILEEKQNRLKQRLESIRMIREEEALAMDIAMQQDSDNSNPST
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaaatcgaggaggagaagcgcacacacacaacattaacaacaacacgaac
aacaacaacaacgcgtttggaggaggaggaggaggacaaggagggaatttcccacgggcg
attgtccccattcaagatgtctccgagattctctccaaatacgatttcaaggagaagatt
ggaaccggaggtttcgcaaccgtcatgcgtgcgatcgagaaagataccggagtagaagtc
gcgatcaagatcgtggaccggcaaaagtacgccccgacggataagagttacgagagagag
tttcaagtgttgtcgacgctctatcacgaaaatatcatcaacttacggtgcacgtacgtg
acggagaagaacgtcttcatggtgactgaagtagttcacggaggggaattgctggagaga
ataaccgaggaaggtagttattccgaggcggacgcgagacggatcatcgttcagatttta
aaagcggttgagtatctacactcgaagaaagtcgttcaccgagacatcaagttagaaaat
attttgatgtccgatcgatctcccaaagcgacggtgaaattgattgattttggattatct
agattaccgcaagtcggaagcgagatgagaacaatttgtggttcgcctttgtacgtcgcg
cctgaaattttagacatgaacttatcggacacggcgtatacgccggcggtggacatgtgg
tccgtcggcgtcattttgtttattttattgagtggctattcaccgttcgatcacgacgac
gaagagcagctgtttaaaaatatcaaagaaggcgtgtattgcatggacgaccgaatttgg
agatacatctcggaaggtgcgaaggattgcgttcgacagttgctcacggtggacgtgatg
aatagaatgactgctacgcaagctttgcaacacccgtggattcgacaaaaacaccatcat
catcaccatcatcatcacaataataataacaacaacgataacaataataataacgatatt
agttcaattatgacgagcgagacgaactcgacgggttttaccgatggcggaggctcgctc
acctcgagcatgaacatgcaacctcccgagcaaatgccaaaggaaattttagaagaaaaa
caaaaccgcttaaaacaacgactagaaagtatacgcatgattcgagaagaagaggcgtta
gcgatggatatagctatgcagcaagatagcgataactccaatccttcgacttga

DBGET integrated database retrieval system