KEGG   Bathycoccus prasinos: Bathy11g00770Help
Entry
Bathy11g00770     CDS       T03089                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpg  Bathycoccus prasinos
Pathway
bpg00010  Glycolysis / Gluconeogenesis
bpg00020  Citrate cycle (TCA cycle)
bpg00620  Pyruvate metabolism
bpg01100  Metabolic pathways
bpg01110  Biosynthesis of secondary metabolites
bpg01200  Carbon metabolism
Module
bpg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bathy11g00770
   00020 Citrate cycle (TCA cycle)
    Bathy11g00770
   00620 Pyruvate metabolism
    Bathy11g00770
Enzymes [BR:bpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bathy11g00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Ribosom_S12_S23
Motif
Other DBs
NCBI-GeneID: 19012757
NCBI-ProteinID: XP_007510168
UniProt: K8FA81
Position
11:complement(134633..135754)
Genome map
AA seq 373 aa AA seqDB search
MRRRIWPSALRLLKEKTLVKSSPSEQSSSSSESLNLLVDAVVASLKDTGAPSSGGSRRVI
AREDVMRFLSSSSSSSSNTNNDRLIENYARIDGTKDASTSSSSDDIGGNERKKKVVVVNS
EFEDVPNSAIRKVIASRLLASKRAQPHSYVTMDVDASGVDRFRKKAMQEHETKVSVNDCI
LYAASKALRRVRKVNSRYDEKLGKRMEFDTVDISVAVAAPTGLVTPIVFNADNKSVSEIG
QDVRRLAGKAKDGKLKPSEMIGGSFTISNLGMFSVDSFQAIQNPPQGAILAVGRGTERVV
ISKSARSDSSSNDDDGNVDKPATDAVFSEDQLSTQLSISATLSIDNRCMDEADASEWLEA
FADEMRKAEDFVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggagaatatggccgtccgcgttgcgtttgttgaaagaaaaaacattagtaaag
tcgtcgccgtctgaacaatcgtcgtcgtcgtctgagtctttgaatcttttggtggacgca
gtcgtggcttcgctgaaggacactggggctccttcctccggaggatcgagaagagtgatc
gcgagagaagacgtgatgcgattcctctcttcttcttcttcttcttcgagtaacacgaac
aacgatcgtctgattgagaactacgccaggattgacgggacgaaagacgcgtcgacgtct
tcttcttccgacgatatcggtgggaatgaaaggaagaaaaaagtagtcgtggtgaactcg
gagtttgaggacgtgccaaacagcgcgattcgaaaagtgatcgcctcgcgactgttagcg
tcgaaacgcgcgcagccgcacagttacgtgactatggacgtggacgcatccggagtggat
cgatttaggaagaaagccatgcaagagcacgagacgaaggtatccgtaaacgactgcatt
ttatacgccgcgtcgaaagcgctgagacgagtaaggaaggtgaattcgaggtacgatgaa
aaattagggaagaggatggagtttgacacggtggatatttcggtagccgtagcagcgcct
acgggtttagtcactccaatcgtgttcaacgcggacaacaaaagtgtctccgaaattggt
caagacgttcgtcgattggctggtaaagcgaaagatggcaagttgaaaccgagcgaaatg
attggagggtcgtttacgatttcgaatttaggcatgttctcggtggactcgtttcaagcc
atacaaaatccaccgcaaggcgctatattagccgtaggaagaggtaccgagcgagtcgtc
atatcaaaaagcgcgagaagtgattcatcatcaaatgacgacgacggcaatgtcgacaaa
cccgcgacggatgcggtctttagcgaggaccaactctcgactcagctgtccatatccgcc
acgttgagcatcgacaacaggtgcatggatgaagcggacgcgagcgagtggttggaggcg
ttcgccgacgagatgcgaaaagccgaagactttgtgctttaa

DBGET integrated database retrieval system