KEGG   Paraburkholderia phymatum: Bphy_0316Help
Entry
Bphy_0316         CDS       T00704                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00900  Terpenoid backbone biosynthesis
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bphy_0316
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bphy_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACC69509
UniProt: B2JCP0
Position
1:complement(357869..358750)
Genome map
AA seq 293 aa AA seqDB search
MIETNDSLRDCLAPAKLNLFLHITGRLPNGYHALQTVFQLLDWGDTLHFTRRDDGAITRG
TDIVDVPADADLTVRAAKLLKEHTGTREGVNIEIDKRLPMGAGLGGGSSDAATTLLALNR
LWKLNLPRAELQVLSVKLGADVPFFVFGKNAFAEGIGEELEQVQLPPRHFLVVTPRVHVP
TSAIFSEKELTRDTKPLTIADFLAQHSCSAEWPDSFGRNDMQQVVAGKYAEVAQVLRWFD
NIAPARMTGSGASVFAAFRSKDEAVAAHAKLPVGWSGAVTASLDTHPLFAFAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacgaacgactcgctgcgcgactgtctcgctccagcgaagctgaacctcttc
ctgcacatcaccggccgtctgccgaacgggtatcacgcgttgcagacagtgttccagttg
ctcgactggggcgacacgctgcacttcacgcgtcgggatgacggcgcgatcacgcgcggc
accgatatcgtcgatgttcccgccgacgccgacctcaccgtgcgcgccgcgaagctgctc
aaggaacacacggggacgcgcgaaggcgtgaacatcgaaatcgacaagcgcctgccgatg
ggtgcgggtctcggcggcggcagctccgatgcggcgacaacgctgctcgcgctgaaccgt
ctatggaagctgaatctgccgcgcgccgaattgcaggtgctctcggtgaaactgggcgca
gatgtgccgttcttcgtgttcggaaaaaatgccttcgcggagggtatcggagaggaactg
gagcaggtacaattgccgccgcgccacttcctggtggtgacaccgagggttcatgttcca
acgtcagcgattttttctgaaaaagagttgacaagagatacgaagcccctcacaatagca
gactttcttgcacagcatagttgcagcgcagaatggccagacagcttcggccggaatgac
atgcagcaggttgtcgcagggaaatacgcggaagttgcgcaggtgcttagatggtttgac
aacatcgcgccggcgcggatgacaggatcaggtgcaagtgtttttgcagcgttccgtagc
aaagatgaagcagtcgcggcgcatgccaaactgccagtcggatggagcggtgcagtaaca
gcaagtctcgatacgcatccactctttgctttcgcggcataa

DBGET integrated database retrieval system