KEGG   Paraburkholderia phymatum: Bphy_0443Help
Entry
Bphy_0443         CDS       T00704                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00020  Citrate cycle (TCA cycle)
bph00640  Propanoate metabolism
bph00660  C5-Branched dibasic acid metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphy_0443
   00640 Propanoate metabolism
    Bphy_0443
   00660 C5-Branched dibasic acid metabolism
    Bphy_0443
Enzymes [BR:bph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bphy_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACC69635
UniProt: B2JDB8
Position
1:502950..504119
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQK
VVVMASSEGGMDIEEVAAKTPEAIHKVAVDPSKGLLDAEADDLAKKIGVPDASIPQARTI
LQGLYKATWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVDLQVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggtcttctcggtggatgatgcggtcaaggccgctgaagagctcggcggc
ccggtgtgggtcgtcaaggctcagatccacgcgggtggccgtggcaagggtggcggcgtg
aaggttgcgaagtcgctggaacaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagactggcccggaaggccagaaggtgaatcgtctgctgatcgaagaa
ggcgctgacatcaagaaggaactgtatgtcggtctcgtgatcgatcgcgtgtcgcaaaag
gtcgtcgtgatggcttcgagcgaaggcggtatggacatcgaagaagtcgccgccaagacg
ccggaagcgatccacaaggtcgccgtcgatccgtcgaagggtctgctggacgcggaagcc
gacgatctggcgaagaagatcggcgtgcccgacgcttcgatcccgcaagcacgcacgatc
ctgcagggcctgtacaaggcgacgtgggaaacggacgcatcgctggccgaaatcaacccg
ttgatcctgacgggcgacggcaaggtgatcgcactggacgccaagttcaacttcgattcg
aacgctctgttccgtcatccggaaatcgtcgcgtaccgcgacctggacgaagaagatccg
gctgaagtcgaagcatcgaaatttgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctggtgaacggcgccggcctggcgatggcgacgatggacacgatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggcggcgccacgaccgaaaaggtcactgaa
gcattcaagctgatgctgaagaacccgaacctgacggcgattctcgtgaacatcttcggc
ggcatcatgcgttgcgacgtgatcgcggaaggcgtgatcgcggcttcgaaggcggtcgat
ctgcaagtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
ctggctgactccggcctgccgatcatctcggcggacagcatggaagaagctgcgcagaag
gtcgtcgcggccgccgcaggcaaggcctga

DBGET integrated database retrieval system