KEGG   Paraburkholderia phymatum: Bphy_0715Help
Entry
Bphy_0715         CDS       T00704                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00970  Aminoacyl-tRNA biosynthesis
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bphy_0715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bph03029]
    Bphy_0715
Enzymes [BR:bph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bphy_0715
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bphy_0715
Mitochondrial biogenesis [BR:bph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bphy_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACC69904
UniProt: B2JEX5
Position
1:complement(804264..805652)
Genome map
AA seq 462 aa AA seqDB search
MSTAMSPEPTPFPPLAQLAADLASGRTTSRALVEAALARIADPAGQGAAVFMQVDADNAR
ATADAHDRLRAAGTVLSPLAGIPVSVKDLFDVEGQVTRAGSTVLANAAPATADAPAVARL
KRAGAVIVGRTNMSEFAFSGLGLNPHYGNPLSPYRRGVKGDERVSGGSSSGAAASVADGM
AAVALGSDTGGSLRIPAALCGLTGFKPTADRVPKQGGVPLSPTLDAFGAIGATVACCALV
DRILAGLEPVIPAARPLEGARLGVLNHYVTDGIEPEVAEAYDAALKHLEAAGAIVSDVRF
APLDRLAEINRFGFSPIEAYAWHRPLLDAHRDAYDPRVLTRILKGQPATAADYLDLLAGR
AAVLAEARTMWQRFDALVAPTVPVVPPRVAELVHDDDAFFRANGLVLRNPSAFNFLDACA
ISVPCHPRGGAPVGLMLAAAPHADDALLGIGRAVEAVLNTIR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccatgtcacccgaacccacgccgtttcccccgctcgcccaactcgctgcc
gatctcgcctccggccgcaccacgagccgcgcgctcgtcgaagccgcgctggcgcggatc
gccgaccccgctggccagggggcggccgtattcatgcaggtcgacgccgataacgcgcgc
gccacggccgatgcgcacgatcgcctacgcgcagccggcaccgtactgtcgccgctcgcg
ggcattcccgtctccgtgaaagacctgttcgacgtcgagggacaggtgacgcgcgccggc
tcgacagtgctggcgaacgcggcacccgccacggcagacgccccggcggtcgcgcgcctg
aagcgcgcgggcgccgtcatcgtcggtcgcacgaacatgagcgagttcgcgttctcgggg
ctcggcctcaacccgcactacggcaatcccctctcgccctaccggcgcggcgtgaagggc
gacgagcgggtgtcgggcggctcgtcgtcgggggcagcagcgtccgtcgcggacggcatg
gcggccgtcgcgctcggcagcgacacgggcggctcgctgcgcattcccgccgcgctgtgc
ggacttaccggcttcaagccgacggccgaccgcgtgcccaaacagggcggcgtaccgctc
tcgccgacacttgatgcattcggcgcgatcggcgcgacagtcgcgtgctgcgcactggtc
gaccggatcctcgccgggctggagcccgtcattccggctgcgcggccgctcgagggcgcg
cggctcggcgtgctgaaccattacgtgacggacggcatcgagccggaagtcgccgaggct
tatgacgccgcgctcaagcatctggaggcggcgggcgcgatcgtcagcgacgtgcgtttt
gcgccgctcgaccggcttgccgaaatcaaccgcttcggcttttcgcccatcgaagcctac
gcgtggcaccggccgctgctcgacgcgcaccgggacgcctacgatccgcgcgtgttgacg
cgcatcctcaaaggccagccggcgacggccgccgactatctcgacctgctcgccgggcgc
gccgcggtgctggccgaggcgcgcacgatgtggcagcgcttcgatgccctcgtcgcgccg
acggtgcccgtcgtgccgccgcgcgtcgccgaactggtgcacgacgacgatgcattcttt
cgtgccaacggcctcgtgctgcgcaatccgagcgccttcaattttctcgatgcctgcgcg
atctctgtgccgtgtcatccgcgcggcggcgcgcccgtcgggctgatgctggccgccgcg
ccgcacgcggacgacgcgctgctgggaattggacgagccgtcgaagcggtgttgaacacc
atccgctga

DBGET integrated database retrieval system