KEGG   Paraburkholderia phymatum: Bphy_0752Help
Entry
Bphy_0752         CDS       T00704                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00540  Lipopolysaccharide biosynthesis
bph01100  Metabolic pathways
Module
bph_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Bphy_0752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bph01005]
    Bphy_0752
Enzymes [BR:bph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Bphy_0752
Lipopolysaccharide biosynthesis proteins [BR:bph01005]
 Unusual sugar
  Bphy_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACC69941
UniProt: B2JF12
Position
1:848702..849694
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGSNLVKALNERGEDGIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
FARGDFGKVRAIFHEGACSDTMETDGRYMMDNNFRYSRAVLDACLAQGVQFLYASSAATY
GGSTRFVEEREVEAPLNVYGYSKFLFDQVIRRVLPTAKSQIAGFRYFNVYGPRESHKARM
ASVAFHNFNQFRAEGKVKLFGEYNGYAAGEQTRDFVSVEDLVKVNLHFFDHPEKSGIFNL
GSGRAQPFNDIASTVVNALRALDGEPALSLAELVQRGLIEYIPFPDALRGKYQCFTQADL
TKLRAAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgtcaccggcgcggctggttttatcggcagcaatctcgtcaaggcgctc
aacgagcgcggcgaagacggcatcatcgccgtcgacaatctgacgcgcgccgacaagttc
aagaatctcgtcgactgtgaaatcgatgactatctcgacaagacggaattcgtcgagcgc
tttgcgcgcggcgacttcggcaaggtgcgcgcgattttccatgagggtgcctgttcggac
acgatggaaaccgacggccgctacatgatggataacaacttccgctatagccgcgcggtg
ctcgatgcgtgtctcgcgcagggcgtgcaatttctgtacgcgtcgtcggcggcgacttat
ggcggctcgacgcgcttcgtcgaagagcgcgaggtcgaggcgccgctgaatgtatacggc
tattcgaagttcctgttcgatcaggtgatccggcgcgtgctgcccaccgcgaagagccag
attgcgggctttcgctacttcaacgtgtacgggccgcgcgaatcgcacaaggcacgcatg
gcttccgtcgcgtttcacaacttcaaccagttccgcgctgaagggaaagtcaagctcttc
ggcgagtacaacggctacgcagcaggcgaacagacgcgcgacttcgtctccgtcgaagac
ctggtgaaggtgaatctgcacttcttcgatcatccggagaagtcgggcatcttcaatctc
ggcagcgggcgtgcgcagccgttcaatgacatcgcgtcgacggtggtcaacgcgctgcgt
gcgctcgacggcgagccggcgttgtcgctcgctgagctggtgcagcgcgggttgatcgag
tacatcccgttccccgacgcgttgcgcggcaagtatcagtgcttcacgcaagccgacctg
acgaagctgcgcgcagcgggctacgacgcgccgttcctgacggtgcaggaaggcgtcgat
cgttacgtgcgttggctatccggccaggtgtaa

DBGET integrated database retrieval system