KEGG   Paraburkholderia phymatum: Bphy_1419Help
Entry
Bphy_1419         CDS       T00704                                 

Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00970  Aminoacyl-tRNA biosynthesis
Module
bph_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bph00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bphy_1419
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bph01007]
    Bphy_1419
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bph03016]
    Bphy_1419
Enzymes [BR:bph01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     Bphy_1419
Amino acid related enzymes [BR:bph01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Bphy_1419
Transfer RNA biogenesis [BR:bph03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bphy_1419
 Prokaryotic Type
    Bphy_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b HGTP_anticodon tRNA-synt_2 tRNA-synt_2d Gp58
Motif
Other DBs
NCBI-ProteinID: ACC70601
UniProt: B2JIV0
Position
1:complement(1598632..1599972)
Genome map
AA seq 446 aa AA seqDB search
MTEQKKRLEKLSGVKGMNDILPQDAGLWEFFETTVKSMLRSYGYQNIRTPIVEHTQLFTR
GIGEVTDIVEKEMYSFTDALNGENLTMRPENTAAVVRASIEHNMLYDGPKRLWYIGPMFR
HERPQRGRYRQFHQVGVEALGFAGPDTDAEIILMCQRLWDDLGLTGIKLEINSLGLAEER
AKHRVELIAYLEKHMDVLDEDAKRRLYTNPLRVLDTKNPALQAVAQNAPKLIDFLGDESR
AHFEGLQRILKANNIPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQ
LGGKPTAACGWAMGIERILELLKEENLVPENEGCDVYVAHQGEAARDQAFIVAERLRDTG
LDVILHCSPDGQASSFKSQMKRADASGAAFAVILGEDEIANGTAGVKALRDSSQSNGKSE
QQTVPLEDLTEYLINAMVASTEDGDD
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagaagaaacggcttgaaaagttgtccggcgtgaagggcatgaacgacatc
cttccgcaggacgcaggcttgtgggagtttttcgaaacgacggtcaaatcgatgctgcgt
tcgtacggataccagaatatccgcacgccgatcgtcgagcatacgcagctcttcacgcgc
ggtatcggcgaagtgaccgacatcgtcgaaaaagagatgtacagtttcaccgacgcgctg
aacggcgagaacctgacgatgcgaccggaaaacacggctgccgtcgtgcgcgcgtcgatc
gagcacaacatgctgtacgacggcccgaagcgtctgtggtacatcggcccgatgttccgc
cacgagcgtccgcagcgtggccgttatcgccagttccatcaggtgggcgtcgaggcactc
ggcttcgccggtccggacactgacgccgaaatcatcctgatgtgtcaacgtctgtgggac
gacctcgggctgacgggcatcaagctcgaaatcaactcgctgggtctcgctgaagagcgg
gcgaagcatcgcgtcgaactgatcgcgtatctcgagaagcacatggatgtgctcgacgaa
gacgcgaagcgccgtctctacacgaacccgctgcgcgtgctggacacgaaaaatccggcc
cttcaggccgtcgcgcagaacgcgcccaagctgatcgatttcctcggcgacgaatcgcgt
gcgcactttgaaggcctgcagcgcatcctcaaggcgaacaacattccgttcacgatcaat
ccgcgtctcgtgcgcggtctggattactacaacctgaccgtctttgaatgggtgaccgac
aagctcggcgcgcaaggcacggtggcggcaggcggccgttacgatccgttgatcgagcaa
ctcggcggcaagccgacggcggcatgcggttgggcgatgggcatcgagcgcattctcgaa
ctgctcaaggaagagaacctcgtgcccgaaaacgaaggctgcgacgtgtatgtcgcgcat
cagggcgaagcggcgcgcgaccaggcgttcatcgtcgcagagcgtttgcgcgacacgggc
ctcgacgtgattctgcattgcagtcctgatggtcaggcgtccagcttcaagtcgcagatg
aaacgcgctgacgcaagcggcgcggcgttcgccgtgatcctgggcgaagacgaaatcgcg
aacggcacggcgggtgtcaaggcgctgcgcgattcgtcgcaaagcaatggaaagagcgag
caacaaacggtgccgctcgaagacttgaccgaatatctaatcaatgcgatggttgcgtcc
accgaagacggcgacgattga

DBGET integrated database retrieval system