KEGG   Paraburkholderia phymatum: Bphy_1791Help
Entry
Bphy_1791         CDS       T00704                                 

Definition
(GenBank) polar amino acid ABC transporter, inner membrane subunit
  KO
K10016  histidine transport system permease protein
Organism
bph  Paraburkholderia phymatum
Pathway
bph02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bphy_1791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bph02000]
    Bphy_1791
Transporters [BR:bph02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bphy_1791
   Histidine transporter
    Bphy_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACC70973
UniProt: B2JCH2
Position
1:complement(2046648..2047337)
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPVLLDGTIKTVELSVLSLATSVVLGLVGAAAKLSLNRPLRALATGYTTLIRSV
PDLVLMLLLFYSIQIAVNNLTDALDLPQFDIDPFIAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGAAYGMSGARVFARILFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALIYLAITTVSNLVLIWLEKRYSIGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctctatggctttggcccggtgctcctcgacggtacgatcaagacggtcgagctg
tccgttctttcgctggcgacgtccgtcgtgctcggcctggtcggcgcggcggcgaagctc
tcgctcaaccggccgctgcgggcactcgcgacgggctatacgacgctgatccgttcggtg
cccgatctggtgctgatgctgctgctgttctacagcatccagatcgcggtcaacaacctg
accgacgcgctcgacctgccgcaattcgacatcgatccgttcatcgcgggcgtgctgacg
ctcggcttcatctacggcgcgtacttcaccgagacctttcgcggtgcgtttctcgccgtg
ccgcgcggccagctcgaagcgggcgcggcgtacggcatgagcggcgcgcgggtatttgcg
cgcatcctgtttccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctggtgaaggcaacggcgctcgtgtcgatcatcggtctcgccgatgtcgtcaaggcc
gcgcaggacgcgggcaagagcacgttcaacatgttcttcttcattctcgtcgccgcgctg
atctatctggccattacgaccgtgtcgaatctcgtgctgatctggctggaaaagcgctat
tcgatcggcgtgcggcacgccgaactctaa

DBGET integrated database retrieval system