KEGG   Paraburkholderia phymatum: Bphy_1938Help
Entry
Bphy_1938         CDS       T00704                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00620  Pyruvate metabolism
bph00640  Propanoate metabolism
bph00680  Methane metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_1938
   00620 Pyruvate metabolism
    Bphy_1938
   00640 Propanoate metabolism
    Bphy_1938
  Energy metabolism
   00680 Methane metabolism
    Bphy_1938
Enzymes [BR:bph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bphy_1938
Lipid biosynthesis proteins [BR:bph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bphy_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1391
Motif
Other DBs
NCBI-ProteinID: ACC71117
UniProt: B2JD61
Position
1:complement(2182091..2184073)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLQERRVFQPSAEVAAQATVSGMDAYKALVAEAERDYEGFWGRLARETLSWNKP
FTKVLDESNAPFYKWYDDGELNASYNSIDRHVEAGNGERVAIIFEADDGTITNVTYNDLL
QRVSRFANALKQRGIKKGDRVVIYMPMSVEGIVAMQACARIGATHSVVFGGFSSKSLNER
LVDVGAVALVTSDEQMRGGKALPLKNIADEALAMGGCEAVKSVIVYQRTGGKIGWDDKRD
LWMHEITASESDHCPPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPTDVFWCTADIGWVTGHSYITYGPLTLGGTQVVFEGVPTYPNAGRFWDMIQKHKVTVF
YTAPTAIRSLIKAAEADPKVHPKSYDLSTLRIIGTVGEPINPEAWVWYYENVGGSRCPIV
DTWWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PSMIRTIWGDPERYKKSYFPEELGGTLYLAGDGSVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVANPLVAEAAVVGRPDDTTGEAVCAFVVLKRARPEGEEAAKIAADLRNWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEEITQDVSTLENPAILDQLGESR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcaagaacgccgcgtgtttcagccttcggccgaagtg
gcggcacaggcgactgtgtccggcatggacgcatacaaggcgctcgtcgccgaggcggag
cgcgattacgaaggcttctggggcaggctggcgcgcgagacgctcagctggaacaagcct
ttcacgaaggtgctcgacgaatcgaacgcacctttctacaagtggtacgacgatggcgag
ctgaacgcgtcgtacaacagcatcgaccggcatgtcgaagcgggtaacggcgagcgcgtc
gcgatcatcttcgaagccgacgacggcaccatcaccaacgtcacatacaacgacctgctg
caacgggtgtcacgcttcgcgaatgcgctgaagcaacgtggcatcaagaagggcgatcgc
gtcgtcatctatatgccgatgtcggtcgaaggcattgtcgcgatgcaggcgtgcgcgcgg
atcggcgcaacgcactcggtggtgttcggcggcttttcttcgaagtcgctgaacgagcgt
ctggtcgacgtgggcgcggttgcgctggtcacgtcggacgaacagatgcgcggcggcaag
gcactgccgctgaagaacatcgccgacgaagcgctcgcgatgggcggctgcgaggccgtg
aaaagcgtgatcgtctatcagcgcacgggcggcaagatcggctgggacgacaagcgcgac
ctgtggatgcacgagatcactgcgagcgagtcggatcactgcccgcccgagtgggtcggc
gccgagcatccgctcttcatcctctacacgtcggggtcgacgggcaaaccgaaaggcgtg
cagcacagcacgggcggctatctgttgtgggccgcccagacgatgaagtggaccttcgac
tggaagccgacggatgtcttctggtgcacggccgacatcggctgggtcacgggccacagc
tacatcacgtatggtccgctcacgctgggtggcacacaggtcgtgttcgaaggcgtgccg
acctatccgaacgcggggcgcttctgggacatgatccagaagcacaaggtcaccgtgttc
tacaccgcgccgacggcgatccgctcgctcatcaaggccgcggaggccgacccgaaagtg
catccgaagagctacgacctgtccaccttgcgcatcatcggcacggtcggcgagccgatc
aatccggaagcgtgggtgtggtactacgaaaacgtgggcggctcgcgctgcccgatcgtc
gatacgtggtggcagacggaaacgggcggccacatgatcacgccgctgccgggcgcgacg
ccgctcgtcccgggttcgtgcacgctgccgctgccgggcatcatggcggcagtggtcgat
gagaccggtcaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgtccgtgg
ccatcgatgatccgcacgatctggggcgaccccgagcgttacaagaagagctacttcccg
gaagaactgggcggcacgctgtatctcgcaggcgacggctcggtgcgcgacaaggagacc
ggctacttcacgatcatgggccgtatcgacgacgtgctgaacgtgtcgggccaccgtctc
ggcacgatggagatcgagtcggcgctggtcgcgaatccgctcgtcgcggaagccgccgtg
gtaggccgtcccgacgacaccacgggcgaagccgtgtgcgcgttcgtggtgctcaagcgc
gcgcgtcccgaaggcgaagaggccgcgaagatcgcggccgatctgcgcaactgggtcggc
aaggaaatcggcccgatcgcgaagccgaaggacatccgtttcggcgacaacctgccaaag
acgcgttcgggcaagatcatgcgccgtctgctgcgctcgctcgcgaagggcgaggagatc
acgcaggacgtctcgacgctcgagaatccggcgattctcgatcaactgggcgagtcgcgc
tga

DBGET integrated database retrieval system