KEGG   Paraburkholderia phymatum: Bphy_2180Help
Entry
Bphy_2180         CDS       T00704                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00620  Pyruvate metabolism
bph00680  Methane metabolism
bph01100  Metabolic pathways
bph01120  Microbial metabolism in diverse environments
bph01200  Carbon metabolism
Module
bph_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_2180
  09102 Energy metabolism
   00680 Methane metabolism
    Bphy_2180
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bphy_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACC71355
UniProt: B2JEP0
Position
1:2444729..2447821
Genome map
AA seq 1030 aa AA seqDB search
MTSSGSARPARRTTASPDAAPASAASTAKATKAEKARKATQALDSRKTGKSTKTKAIKAK
APVNGASRRIKADVKPSKAIRHDAPASAVKDDGRTREDKDQPLFEDIRYLGRLLGDVVRE
QEGDEVFDVVETIRQTAVRFRREDDSVAAQALDKKLRALSPEQTVSVVRAFSYFSHLANI
AEDRHRNRRHRIHDLAGSTSQPGTIAHALDRLVEANAAATPVLQQFFNDALIVPVLTAHP
TEVQRKSILDAQHDIARLLAERDQPLTAREHLQNDSLLRARVTSLWQTRMLRDSRLTVAD
EIENALSYYRATFLEEIPQLYADIEEALVEHGLDARLPPFFQMGSWIGGDRDGNPNVTGE
TLENAITRQAAVIFEHYLEQVHKLGAELSVSNLLAGASDELKALAQASPDHSPHRTDEPY
RRALIGMYTRLAASARVRLGEGVVPVRSAGPGIPPIRAVPYGDSSEFVRDLHVLIDSLAE
HHGASLATPRLSPLTRAAEVFGFHLASIDLRQSSDIHEAVIAELFKRAGVESDYAALSEA
EKLRVLLAELAQPRLLRSPYVDYSNLVKSELGVLEQARVTREKFGARAVRNYIISHTETV
SDLVEVMLLQKEAGLLQGTLGSATHPARAGLMVIPLFETIPDLRNAPHIMRDLLALPGID
AIIENQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNERGITMRLFHGRGGTV
GRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPDIGRRNLETVVAATLEASLLP
HGSAPKSQLPEFEETMQVLSDAAMASYRALVYETPGFTDYFFSSTPIAEIAELNIGSRPA
SRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAGWLDAAGANMERERRLNQ
LRKMHKVWPFFSNLLSNMDMVLAKTDLAVASRYAALVTDKKLRKHVFERIVAEWERTSNV
LSEITGQKERLSDNPLLARSIKNRFPYLDPLNHLQVELLKRHRAGDTNVRVRRGIHLTIN
GIAAGLRNTG
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccctgcccgccgcactactgcctcgcccgatgccgcg
cccgcatcggcagcttccaccgccaaggccacgaaggccgagaaggcgcggaaagcaacg
caagccctcgactcccgcaaaaccggcaaatccacgaagaccaaggctataaaagccaag
gcgcccgtcaatggcgcctcccggcggatcaaggcggacgtcaagccgtcgaaagccatc
aggcatgacgcacccgcgtccgccgtgaaggacgacggccgcacgcgcgaggacaaggac
cagccgctcttcgaagacatccgctatctggggcggctgctcggcgacgtggtgcgcgag
caggaaggcgacgaagtgttcgacgtcgtcgagacgatccgtcagacggctgtgcgcttt
cgccgcgaggacgacagcgtcgcggcgcaggcgctcgacaagaagctgcgcgcgctctcg
cccgaacagacggtgagcgtggtgcgcgcgttcagctacttctcgcatctggcgaacatc
gcggaagaccgtcatcgcaaccgccggcaccggattcacgacctggccggctcgacctcg
cagccgggcacgatcgcgcatgcgctcgaccggctcgtcgaagcgaacgcggccgccacg
cccgtgctgcagcagttcttcaacgacgcgctgatcgtccccgtgctgacggcgcacccg
acggaagtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcggctgctcgcc
gaacgcgaccagccgctgacggcgcgcgagcatctgcagaacgactcgctgctgcgcgca
cgcgtgacgtcgctgtggcagacgcggatgctgcgcgattcgcgcctgaccgtcgccgac
gaaatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgaagaaattccgcagctg
tacgccgatattgaagaagcgctcgtcgagcacggcctcgacgcgcgcctgccccccttc
ttccagatgggcagctggatcggcggcgaccgcgacggcaacccgaacgtcacgggcgag
acgctggagaacgcgatcacgcgccaggccgcggtgatcttcgaacattatctggagcag
gtccacaagctcggcgccgagctgtcggtgtcgaacctgctggcgggcgcaagcgacgaa
ctgaaggcgctcgcccaagcgtcgccggatcactcgccgcatcgcaccgacgagccgtat
cggcgcgcgctgatcggcatgtacacgcgccttgccgcgagcgcgcgggtgcgtctgggc
gaaggcgtggtgcccgtgcgcagcgccggcccgggcattccgcccatccgcgccgtgcca
tacggcgattcgtccgagttcgtgcgcgacctgcacgtgctgatcgattcgctcgccgag
catcacggcgcgtcgctcgcgacgccgcgcctgtcgccgctcacgcgcgcggccgaagta
ttcggcttccatctcgcgagtatcgatctgcgccaaagctcggacattcatgaagccgtg
atcgcggagctgttcaaacgcgcgggtgtcgaaagcgattacgcggcgctctccgaagcg
gagaagctgcgcgtgctgctggcagaactcgcgcagccgcgcctgttgcgctcgccgtat
gtcgactattcgaacctcgtgaagagcgagctgggcgtgctcgaacaggcgcgcgtgacg
cgcgaaaagttcggtgcgcgcgcggtgcgcaactacatcatttcgcacacggagacggtc
agcgatctcgtcgaagtgatgctgctgcagaaagaagcggggctgctgcaaggcacactc
ggcagcgcgacccatccggcgcgcgccggcctgatggtgatccctctcttcgagacgatt
cccgatttgcgcaacgcgccgcacatcatgcgcgatctgcttgcactgccgggcatcgat
gccatcatcgagaaccagggcaacgagcaagaagtgatgctcggctattcggacagcaac
aaggacggcggcttcctgacgtcgaactgggaactctaccgtgcggaactggcgctcgtc
tcgctcttcaacgagcgcggcatcacgatgcgcctgttccacgggcgcggcggcacggtc
ggacgcggcggcggcccgacctatcaggcgatcctgtcgcagccgcccggcaccgtcgac
ggtcagatccgcctgacggaacagggcgaagtgatcgccagcaagttcggcaaccccgac
atcggccgacgcaatctggagacggtcgtcgccgcgacgctcgaagcgtcgctgctgccg
cacggcagcgcgcccaagtcgcaactgccggagttcgaagagacgatgcaggtgttgtcc
gacgcggcgatggcgtcgtaccgtgcactcgtctacgagacgcccggattcaccgattac
ttcttctcgtcgacgccgattgcggagatcgccgagctgaacatcggcagccgtcccgcc
tcgcgcaagctgcaggatccgaagcaacgcaagatcgaagatttgcgcgcgattccgtgg
ggcttctcatggggtcaatgccggctgctgctgacgggctggtatggctttggcagcgcg
gtcgccggctggctcgatgcggcgggtgccaatatggagcgtgagcgccgtctgaaccag
ctgcgcaagatgcacaaggtgtggccgttcttttcgaatctgctgtcgaacatggacatg
gtgctggcgaagacggacctcgcagtggcatcgcgctatgccgcgctcgtgactgacaag
aagctgcgcaagcatgtattcgagcggatcgtggccgaatgggaacgcacgtcgaatgtg
ctgtccgagattaccggccagaaggagcgtctttccgataacccgttgttggcgcggtcg
atcaagaatcgctttccgtatctcgatccgttgaatcacctgcaggtcgaactgctaaag
cgccatcgcgcaggggatacgaacgtgcgcgtgcggcgcgggattcatttgacgatcaac
ggcattgcggccgggttgaggaataccggctga

DBGET integrated database retrieval system