KEGG   Paraburkholderia phymatum: Bphy_2246Help
Entry
Bphy_2246         CDS       T00704                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bph  Paraburkholderia phymatum
Brite
Enzymes [BR:bph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bphy_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_23 MTS Methyltransf_11 PrmA Methyltransf_12 Methyltransf_18 RrnaAD Methyltransf_32 Met_10 Ubie_methyltran DUF938 Methyltransf_16 UPF0146 CMAS ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACC71421
UniProt: B2JEV6
Position
1:2520626..2521279
Genome map
AA seq 217 aa AA seqDB search
MNIEQARFNMIEQQIRPWEVLDQDVLNLLSIVKRENFVPAAYRELAFVDFEVPLPAGQHM
LAPRVEARVLQELAVKKHESVLEIGAGSGYMAALLAHRALHVLTVDIEPELAGLAKANLA
ANGVLNAEVATGDGARGWAAAAPYDIICVSGGLPVLPQEILEQLKVGGRLAAFVGTAPVM
KAQIITRVDEKQFRIADVFETYVEPLQNAVHAPRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaacaagcgcgtttcaacatgattgaacagcaaatccgtccgtgggaagtg
ctcgaccaggacgtgctgaatctgctgtcgatcgtcaagcgtgagaatttcgtgcccgcc
gcctatcgcgagctggcgttcgtcgatttcgaagttccgctgcccgccggacagcacatg
ctcgccccacgcgtcgaggcacgcgtgctgcaggaactggcggtcaagaagcacgagtcg
gtgctggaaatcggcgcgggttcgggctacatggccgcgctcctcgcgcaccgcgcactg
cacgtgctgacggtggatatcgagccagaactggccggactcgccaaggcgaatctcgcc
gcgaacggcgtgctgaatgccgaagtcgccacgggcgacggcgcacgcggctgggcggct
gccgcgccgtacgacatcatctgcgtgtcgggcggcctgcccgtcctgcctcaggaaatc
ctcgagcaactgaaggtcggtggccgcctcgccgcgttcgtcggcaccgcgcccgtgatg
aaggcgcaaatcatcacgcgcgtcgacgagaagcagttccgcatcgccgacgtgttcgaa
acctatgtcgaaccgctgcagaacgccgtgcacgcgccgcgcttcaagttctga

DBGET integrated database retrieval system