KEGG   Paraburkholderia phymatum: Bphy_2324Help
Entry
Bphy_2324         CDS       T00704                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00240  Pyrimidine metabolism
bph00250  Alanine, aspartate and glutamate metabolism
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bphy_2324
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bphy_2324
Enzymes [BR:bph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bphy_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACC71499
UniProt: B2JFD1
Position
1:complement(2608798..2609838)
Genome map
AA seq 346 aa AA seqDB search
MNTPNPVSQGSTVSADNPAPADRFRYGFLKGNPQLTKNGELKHLLTIEGLPRAIVTHILD
TAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASST
SKGESLLDTINNLSAMHADMFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLL
DMYTIRHYKRDFTNLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQM
GVRVFHNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAKPDAIVM
HPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNND
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccaacccggtttcccaaggttccaccgtttccgcggataaccccgcgcca
gcggaccgttttcgctacggtttcctgaagggcaatccgcagctcacgaagaacggcgag
ctgaagcatctgctcaccatcgagggactgccgcgcgcaatcgtcacgcacattctcgat
acggccgagcagttcgtcagcgtgaccgaccgcgaggtgaagaaggtgccgctgctgcgc
ggcaaatcggtattcaacctgtttttcgagaactcgacgcgcacgcgcaccacgttcgaa
atcgccgcgaaacggctgtcggcggacgtgatcaacctgaacatcaacgcgtcgtcgacg
agcaagggcgaatcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacatg
ttcgtcgtgcgtcacgcgtcgagtggcgcgccgtatctgatcgccgagcattgtgcgccg
cacgtgcacgtgatcaacgcgggtgacggccgccacgcacatccgacgcagggcctgctc
gacatgtacacgatccgccactacaagcgcgatttcaccaatctgcgcgtggcgatcgtc
ggcgacattctgcattcgcgcgttgcacgttcggacatccacgcgctcaccacgctcggc
gtacccgaagtgcgcgcgatcggtccgcgtacgctgctgccgggcggcctcgagcagatg
ggggtgcgcgtgttccataacctcgacgaagggttgaaggacgttgacgtgatcatcatg
ctgcgtctgcagaacgagcggatgagcggtgcattgctgccgtcggcgcaggaatacttc
aagagctgggggctgacgcccgagcgtctcgcgctggcgaagcccgacgcgatcgtgatg
catccgggaccgatgaaccgcggcgtcgagatcgattcgcaggtggcggacggtccgcaa
tcggtgattctcaatcaggtgacgttcggcatcgcggttcgcatggcggtgatgggcatc
gtcgcgggcaacaacgactga

DBGET integrated database retrieval system