KEGG   Paraburkholderia phymatum: Bphy_2668Help
Entry
Bphy_2668         CDS       T00704                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
bph  Paraburkholderia phymatum
Brite
Chromosome and associated proteins [BR:bph03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Bphy_2668
Cytoskeleton proteins [BR:bph04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   Bphy_2668
Prokaryotic defense system [BR:bph02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Bphy_2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2
Motif
Other DBs
NCBI-ProteinID: ACC71840
UniProt: B2JHF5
Position
1:complement(3009423..3010616)
Genome map
AA seq 397 aa AA seqDB search
MEFQMLETETNGTIIKVVGVGGAGGNAVMHMINRGVQGVDFIVMNTDAQALSRSRAPNVI
QLGNTGLGAGAKPEMGRAAAEEARERIADALRGAHMVFITAGMGGGTGTGAAPVVAQIAK
EMGILTVGVVSKPFEFEGGKRMRVAEAGSQQLEDHVDSLIVVLNDKLFEVMGDDAEMDKC
FQCADDVLNNAVAGIAEIINVDGLVNVDFEDVKTVMGEQGKAMMGTATVAGVDRARLAAE
QAVASPLLEGVDLSGARGVLVNITSSRSLRLSETREVMNTIKSYAADDATVIFGAVYDDA
MGDALRVTVVATGLGRAAKKQQQTPMTLLRTGTDNQPVGAMQHVYTPQHAATADYGSLDT
PAVWRTSRDTAASHVQALQEKGVDTYDIPAFLRKQAD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaattccagatgctggaaacggaaaccaacggcaccatcatcaaggtggtgggcgtc
ggtggtgcgggcggcaatgccgtcatgcacatgatcaatcgcggcgtgcaaggcgtcgac
ttcatcgtgatgaacacggacgctcaggcgctgtcgcgctcgcgcgcgccgaacgtcatc
cagttgggcaatacgggtctgggcgcaggcgccaagccggaaatgggccgcgcagcagca
gaagaggcacgtgagcgcatcgcggacgcactgcgtggtgcacacatggtgttcatcacg
gcaggcatgggcggcggcacgggcacgggcgcagcacccgtggtcgcgcagatcgccaag
gaaatgggcattctgacggtgggcgtggtcagcaagccgttcgagttcgaaggcggcaag
cgcatgcgcgtcgccgaagccggttcgcagcaactggaggatcacgtcgactcgctgatc
gtcgttctgaacgacaagctgttcgaggtgatgggcgatgacgccgaaatggacaagtgc
ttccagtgcgctgacgacgtgctcaacaacgcagttgccggtatcgccgaaatcatcaac
gtcgacggtctggtgaacgtcgacttcgaagacgtgaagacggtgatgggcgagcagggc
aaggcgatgatgggcacggcgacggtggccggcgtcgatcgcgcgcgtctcgcggcggaa
caggctgtcgccagcccgctgctggaaggtgtcgatctgtcgggcgcacgtggcgtactg
gtgaacatcacgtcgagccgctcgctgcgtctgtcggaaacgcgcgaagtgatgaacacg
atcaagagctatgctgctgatgacgcgaccgtgattttcggcgccgtgtacgacgacgcg
atgggcgatgcgctgcgcgtaaccgtggtggcaacgggcctgggccgcgcagcgaagaaa
cagcagcaaacgccgatgacgctgctgcgcacgggcacggacaaccagccggtcggcgcc
atgcagcacgtgtacacgccgcagcatgcagcgacggcggactacggttcgctggacacg
ccggcagtttggcgtacctcgcgtgacacggctgcttcgcacgtgcaggcgctgcaggaa
aagggcgtcgatacgtacgacatcccggccttcttgcgcaagcaggcagactga

DBGET integrated database retrieval system