KEGG   Paraburkholderia phymatum: Bphy_2695Help
Entry
Bphy_2695         CDS       T00704                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
bph  Paraburkholderia phymatum
Brite
KEGG Orthology (KO) [BR:bph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bphy_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ACC71867
UniProt: B2JHI2
Position
1:complement(3048915..3049289)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSSQVRYIAEESDPEHRKYAFAYTLTIRNTGQVTAQLIARHWLITDSENRVQE
VKGLGVVGHQPLLKPGEQFEYTSYAVIATPVGTMRGEYFCVAEDGERWDAPVPEFVLRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtacgaattcagcgtgtcttcccaggtccggtatatcgccgaagagtcggac
ccggagcatcggaaatacgctttcgcatacacgctcaccatccgcaatacgggccaggtg
accgcgcagctgatcgcgcgtcactggctgattacggatagcgaaaatcgcgttcaggaa
gtgaaagggttgggcgtggtcgggcatcagccgttgctgaagccgggcgagcagttcgag
tacacgagctacgccgtgatcgcgacgcctgtcggaacaatgcgcggcgagtatttctgc
gtggccgaggatggcgagcgctgggatgcgcccgtgccggaattcgttctgcgcatgccg
cgcacgctgcattga

DBGET integrated database retrieval system