KEGG   Paraburkholderia phymatum: Bphy_2701Help
Entry
Bphy_2701         CDS       T00704                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01130  Biosynthesis of antibiotics
bph01230  Biosynthesis of amino acids
Module
bph_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphy_2701
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bphy_2701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACC71873
UniProt: B2JHI8
Position
1:3054545..3055330
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIDVKRQEVRAAQQSAPLEELRLQASTRDLRDFVGAIRAKHEAGLAAVIAEVK
KASPSKGVLREHFVPADIARSYANHGAACLSVLTDVQFFKGSAQYLEEARAACQLPVLRK
DFIVDPYQILEARAMGADAILLIVAALETSQMQDLEAYAHSLGLAVLVEVHDKDELVEAL
TLKTPLIGVNNRNLRTFETSIDTTLGLLDMMPDDRIVVTESGILSRTDVERMRAMDVNTF
LVGEAFMRADEPGVELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcgaccgcatcatcgacgtcaagcgccaagaagtgcgcgccgcgcag
caaagcgcgccgctcgaagaactgcgtctccaggcatccacacgcgatctgcgcgatttc
gtcggcgcaatccgcgccaagcacgaggccggtctcgcggccgtgatcgccgaggtcaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcacttcgtccccgccgatatcgcgcgt
tcgtatgccaatcatggcgcagcatgtctgtccgtgctgaccgacgtgcagttcttcaag
ggcagcgcacagtatctggaagaagcgcgcgccgcctgccagttgcccgtgctgcgcaag
gacttcatcgtcgatccgtatcagatcctcgaagcgcgcgcgatgggcgccgacgcgatc
ctgctgatcgtcgcagcactcgaaacctcgcagatgcaggacctcgaagcgtacgcgcac
tcgctcggtctcgcggtgctcgtcgaagtgcacgacaaggacgaactggtcgaagcgctg
acgctgaagacgccgctgatcggcgtgaacaaccgcaatctgcgcacgttcgaaacttcg
atcgacacgacgctcggcctgctcgacatgatgccggacgaccgcatcgtcgtgaccgaa
tccggcattctgtcgcgcaccgacgtcgagcggatgcgcgcgatggacgtgaacacgttc
ctcgtcggcgaggcgttcatgcgtgccgacgagccgggcgtggaacttgcgcggatgttc
ttctga

DBGET integrated database retrieval system