KEGG   Paraburkholderia phymatum: Bphy_2995Help
Entry
Bphy_2995         CDS       T00704                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00520  Amino sugar and nucleotide sugar metabolism
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_2995
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Bphy_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ACC72165
UniProt: B2JJ63
Position
1:complement(3355485..3356426)
Genome map
AA seq 313 aa AA seqDB search
MNAQSVLITGGAGFLGSHLCDRLVAAGHDVMCVDNFHTGSKQTIHHLIGKVNFEVIRHDV
WLPLYVEADRVFNMACPASPVHYQSDPVSTVKTAVLGAINMLGLAKRCGARILQASTSEV
YGDAQQHPQRETYWGNVNPNGPRACYDEGKRCAETLFFDYHRQHGVDIRIARIFNTYGPR
MRPDDGRVVSNFIMQALHGEPITLYGDGSQTRSFCYVDDLVEGLMRLMNHEGEPGPFNIG
NPGEITIRELAEMVLRLTGSRSRIQYRPLPPDDPVQRRPDIAKAREHLDWQPGVALEDGL
KETIAYFKKVVNQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacagtcggtcctgatcacgggcggcgcggggtttctcggctcgcatctgtgc
gaccggctggttgcggccggtcacgacgtgatgtgcgtggacaacttccatacgggcagc
aagcagaccattcaccacctgatcggcaaggtgaatttcgaggtgatacgccatgacgtg
tggctgccgctgtacgtcgaagcggaccgcgtgttcaacatggcatgtcccgcgagccct
gtgcattaccagagcgatcccgtgtcgaccgtgaagacggccgtgctcggcgcaatcaac
atgctcgggcttgcgaagcgctgcggcgcgcgcattctgcaggcgtcgacgagcgaagtc
tacggcgacgcgcagcagcatccgcagcgcgagacatactggggcaatgtgaacccgaac
gggccgcgcgcctgttacgacgaaggcaagcgctgcgcggaaacgctgttcttcgattat
caccgtcagcacggcgtcgacattcgcatcgcgcgaatcttcaacacgtacggtccgcgt
atgcgtcccgacgatggccgcgtggtgtcgaacttcatcatgcaggcgctgcacggcgaa
ccgatcacgctgtacggcgacggcagccagacgcgttcgttctgctatgtcgacgatctc
gtcgaagggctaatgcgcctgatgaatcacgaaggtgagccggggccgttcaacatcggc
aatccgggcgagatcacgatccgcgagctcgcggagatggtgttgcgtctcacgggctcg
cgctcgcgcatccagtaccgaccgctgccgcccgacgatcccgtgcagcgtcgccccgac
atcgcgaaggcccgcgagcatctcgactggcaaccgggcgtggcgctcgaagacggtctc
aaggagaccatcgcgtacttcaaaaaggtagtgaaccaatga

DBGET integrated database retrieval system